KEGG   Glycine max (soybean): 100782778Help
Entry
100782778         CDS       T01710                                 

Definition
ubiquitin carboxyl-terminal hydrolase 26-like
Orthology
K11858  
ubiquitin carboxyl-terminal hydrolase 48 [EC:3.1.2.15]
Organism
gmx  Glycine max (soybean)
Brite
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100782778
Peptidases [BR:gmx01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100782778
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 1096 aa AA seqDB search
MSRPTTRSKNKRQKQGDDGNGTSEIWRKIHNTGVVSKDDMNQLYMIWKPVCSGCRVNTKD
NPNCFCALVPPPNGARKSGLWQKMSDVVESLGHDPTKDLRASADSPAGLTNLGATCYANC
ILQCLYMNKSFREGMFSVERDVLQQHPVLDQLARLFVQLHISKMAFIDSSPFVKTLELDN
GVQQDSHEFLTLLLSLLERCLSHSKVPKATTIVQDLFRGSVSHVTTCSQCGRDSEASSKM
EDFYELELNVKGLKSLDESLDEYLTAEELNGDNQYFCESCKTRVDATRSIKLCTLPKVLN
FQLKRYVFLPKTTTKKKVTSAFSFPAELDMRHRMSELSQFNLVYDLSAVLIHKGTGANSG
HYIAHIKDVNTGQWWEFDDEHVTNLGFHPFGEESSSSTTKSIKTDAIHSDNSEAMVADSN
GNGLNATHSLSSQVETFLSSDAYMLMYHLKQTKNVGESGGVICGANHKESEGVVVAVQNG
VPLPSHIYDEIQSFNASYDDACRRYNNRKELELSLISERRQEVRSVLAEAPVQPLEQPFY
WISSEWLRQWADNIIPIPLDNTPVQCSHGKVPVSKVTSMKRLSAKAWDTLFSKYGGGPAL
SHDNHCRDCLIHGAMTVVSADTYRDRRESMKSLARDILDGNCLDGKYYISRPWLQQWWKR
KVLDAPSEADAGPTAAISCPHGQLMPEQAPGAKRVLIPEIFWLFLYEDAVSVKPDDPLGG
PTFSSDSDECSQCSNELSEVACLEDSLRLVKQKQRQNHEKLFQAKSLQLSLHSKYFLVPL
SWISKWRNYISPTLKNSDKPETLDGVIDSLLCEKHSRLIERPPELVFRRGAIIQRESSAG
GLTIVSENDWKCFCEEWGGIETKGISATIDHVNDSENVLTGSSEEMQVCKDQLSTADKMN
FENGTGQNLIKTCPEVCESCIGERESCELMQKLNYCNEDICVILVRGKEVPRSILEASKG
FVETDRRVSKRSRKSKNGNSISLKVSASTSLYQLKMMIWESFGVVKENQILHKGDRIIVG
DDECATLADVNIFAGDQIIVRDSEIHENRDIADELCDDKMDLQHTEEGFRGTLLTANVSS
QEPPPNHESQPESTGS
NT seq 3291 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaccaacaacacggagtaaaaataaaagacagaaacaaggggatgatggcaat
ggcactagtgaaatatggaggaaaattcataatacaggggtggtatccaaggatgacatg
aatcaattgtatatgatttggaagccagtttgttcaggctgccgtgtcaataccaaagat
aacccaaattgcttctgtgcattggttccacctccaaatggagcccggaagtctggctta
tggcaaaagatgtcagatgttgttgagagtcttggccatgacccaaccaaggatcttcga
gcttctgctgattctcctgcaggtctcacaaatctgggagcaacatgctatgccaactgt
atactccagtgcttgtacatgaataaatctttccgagaaggcatgttttctgtagaacga
gatgttttacaacaacaccctgtgctggatcagctggctcgactttttgtgcagttgcat
attagtaaaatggctttcatagattcttctccatttgtaaaaacactggaattagataat
ggagttcagcaggatagccatgagttcctgacattgcttctctctttgcttgagcgttgt
ctgagccattccaaagtgcccaaggcaacaacaatagttcaagatcttttccgaggaagt
gtttctcatgtgacgacgtgctcacaatgtggaagagactctgaagcttcttccaaaatg
gaagatttctatgaattggagttgaatgtcaaaggattgaaaagtttagatgagagccta
gatgaatatctcactgctgaagagcttaatggggacaatcaatatttttgtgagtcgtgt
aaaacaagagttgatgctactcgcagcatcaagctgtgtacattacccaaagtacttaat
tttcagcttaaacgttatgtcttccttcctaagactacaacaaagaagaaagttacttct
gcattttcatttcctgctgaacttgatatgcggcatagaatgtctgagttgtctcagttc
aacttggtatatgacttgtcagctgtactgattcacaagggaactggtgctaatagtggc
cattacattgctcacatcaaggatgtaaacactgggcaatggtgggaatttgatgatgag
catgttactaatttgggttttcatccatttggtgaagagtcttcaagttctactactaaa
tccatcaagactgatgcaattcattctgataattctgaagcaatggtagctgacagtaat
ggaaatggtttaaatgctactcattcactatcttcacaagtggagacatttttgtctagt
gatgcgtacatgttgatgtaccatcttaaacaaacaaaaaatgttggtgaaagtgggggt
gtaatttgtggtgctaaccataaagaaagcgagggtgttgtagttgctgtgcaaaatggt
gttcctcttccatctcatatttatgatgagattcaaagtttcaatgcctcatatgatgat
gcttgtcggcggtacaataataggaaagagttagaattgagtcttattagtgagagaaga
caggaagttcgatctgttttagctgaagctcctgttcaaccattggagcagccattttat
tggatttctagtgaatggcttcgtcaatgggcagacaacattattccaattcctcttgac
aacacgccggtccaatgctcacatgggaaagtcccagtttcaaaggttacctcaatgaag
cggttgtctgctaaagcatgggatacattgttctccaagtatggtggaggaccagcattg
tctcatgataaccactgtcgggattgcctgattcatggggctatgacagtggtgtcagct
gacacctatcgggatagaagagaatcaatgaagtcacttgcacgggatattctagatgga
aactgcctagatggaaagtattacatatccagaccatggttgcagcagtggtggaaaaga
aaagtccttgatgctccatctgaagctgatgctggaccaacagcagccattagttgtcca
catggtcaattgatgccagagcaagctcctggtgctaagcgggtgcttattcctgagatc
ttttggctcttcttatatgaagatgctgtttctgtaaagcctgatgatcctttgggtggc
ccaactttttcttcagattctgatgagtgttcccaatgcagtaatgaattatctgaagta
gcatgcttggaggactccttgagattagttaaacaaaaacaacgtcagaatcatgagaaa
ttattccaggctaaaagtttgcaactttctctgcacagcaagtatttcttggtgcctttg
tcatggatttcaaaatggagaaattacattagtccaaccctgaagaattcagataaacct
gaaaccttagatggggtaattgactcactgttgtgtgaaaagcactcacggctaattgaa
agacctcctgaattggttttcagacgtggtgctataatccagagggaatcttctgcaggt
ggcttaaccattgtatctgagaatgattggaaatgcttctgtgaagaatggggcggtatt
gagaccaaaggaatatcagcaacaattgatcatgttaatgattcagagaatgtattgact
ggatccagtgaagagatgcaagtatgcaaggatcagttgagcacagcagataaaatgaat
tttgaaaatgggactggacaaaatttaattaagacttgtcctgaggtttgtgaaagttgc
atcggagaaagggagagctgtgagctaatgcagaagcttaactattgcaatgaggacata
tgtgtaattcttgttcgtggtaaggaggtacccagatcaatattggaggcttcaaaggga
ttcgttgaaacagatcggcgagtttcaaaacgttcccgcaagtctaaaaatgggaattca
attagtctaaaagtttctgcttcaacatctttatatcagctgaaaatgatgatatgggaa
tcctttggggttgtcaaggaaaaccagatactacataaaggtgataggataattgttggc
gatgatgaatgtgctaccctcgcagatgtgaacatatttgctggagatcagattatagtg
agggactctgagatccatgaaaatcgagatattgctgatgagctttgtgatgataaaatg
gatctgcagcataccgaggaagggttccggggaacacttctcacagcaaatgtttcatcc
caggagcctccaccgaaccatgaatcccagccagaatctactggatcttaa

DBGET integrated database retrieval system