KEGG   Glycine max (soybean): 100782819Help
Entry
100782819         CDS       T01710                                 

Definition
replication protein A 32 kDa subunit B-like
Orthology
K10739  
replication factor A2
Organism
gmx  Glycine max (soybean)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:gmx03030]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:gmx03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:gmx03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:gmx03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 277 aa AA seqDB search
MYSSASQFDGNAAFSGGGFMPSQTTQGPDSSFVPSKNRDAQSLLPLTVKQIYDASQSSDD
KINLIIDGVDVTNVTLVGRVSNKAGRITDVTFVLDDGTGRIECNKWLHEAVDTNEAEAIL
EGMYARLHGQLKHFQGKRTLNVFSFRPVTDFNEIASHFTDCIYVHLYNSKLRTSVPNQQH
SSPIPPTIGYQAQVVPPTNQFSDQHVNGQKGVTVEAMVLDFLHHPANSSRNEGVHRDHIA
QHLGISLDKLMLAVKNLIDEGAIYETIGDHYKSIING
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgtattcgagtgcaagccagtttgacggcaatgcagccttctccggtggtggattcatg
ccttctcagaccacccagggccctgactcttcattcgttccctccaagaatcgtgacgct
cagtccttgcttcctctgacggtgaagcagatatacgatgcgtctcagtcaagtgatgat
aaaatcaatttgatcattgacggtgtggacgttaccaatgtcactcttgtaggaagggtg
tccaacaaagctggacgaattactgatgttacttttgtgcttgatgatggtacgggaagg
attgagtgtaataaatggcttcatgaagctgttgatacaaatgaagcagaggctatcttg
gaaggaatgtatgcgaggctccatggacaattgaaacattttcagggtaaaaggacctta
aatgttttctcatttaggcctgtgactgactttaatgagattgctagtcatttcaccgac
tgcatatatgtgcatctctacaattccaaattaaggactagtgtccctaatcagcagcat
tcctcaccaattcctcccacaataggttatcaagctcaagttgttccgccaacaaatcag
ttctctgatcagcatgtcaatggtcagaagggtgttactgttgaagccatggtcttagat
tttttgcatcatcccgcaaacagctcaaggaatgagggggtccatcgtgatcatattgca
caacatcttggaatttctttggataagctcatgctggctgttaaaaatcttattgatgaa
ggtgccatttatgaaaccataggtgatcactataagtcaatcatcaatggttga

DBGET integrated database retrieval system