KEGG   Glycine max (soybean): 100782820Help
Entry
100782820         CDS       T01710                                 

Definition
malate synthase, glyoxysomal-like
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
gmx  Glycine max (soybean)
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:gmx01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:gmx00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:gmx00630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 556 aa AA seqDB search
MDLGTYEVPEGVDILGRYDAEFAKILTKDALKFVAELQREFRSDIKHALESRREAKKKYN
EGTLPGFDPATSHIRDQEWLCAPVPPAAADRKVEITGPVDRKMVINALNSAAKVFMADLE
DALSPTWENLISGQVNLKDAVDGTISFHDKVRNRVYKLNDQTAKLFVRPRGWHLPEAHIL
IDGEPATGCLVDFGLYFYHNHSAFRRTQGAGFGPFFYLPKMEHSREAKIWNSVFEKAEDV
AGIERGSIRATVLIETLPAVFQMDEILYELKEHSVGLNCGRWDYIFSYVKTFQTHPDRLL
PDRVQVGMTQHFMKSYSDLLIRTCHRRGVHAMGGMAAQIPIKDDPVANEAALELVRKDKL
REVKAGHDGTWAAHPGLIPSCMEVFNNNMGNAPNQIDTVKRDDAANLTEQDLLQIPTGTR
TMEGLRLNTRVGIQYLAAWLSGSGCVPLYNLMEDAATAEISRVQNWQWLKYGVELDGDGL
GEKVNKDLFHRVVEEEMARIEKEVGTEKFEKGMYKEACKIFTRQCTSLTLDDFLTLDAYN
YIVVHHPKEGTVKASN
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggacctcggaacctatgaagtgccagaaggagtggacattctaggaagatacgatgca
gagtttgcaaaaatcctcacaaaagacgctttgaaattcgttgctgagctgcaacgtgag
ttcaggagcgatatcaagcatgcattagagagcagaagagaggcaaagaagaagtacaat
gaagggactcttccggggtttgatcctgccaccagtcacattagagaccaggagtggctg
tgtgcacctgttccaccagctgctgctgataggaaagtggagatcactggccctgtggac
agaaaaatggtcatcaatgctctcaactctgcagctaaagtctttatggctgatttagaa
gatgcactgtcaccgacctgggaaaatcttattagtggtcaagtgaacttgaaggatgct
gtggatgggacaataagcttccatgacaaagtaagaaacagggtttacaagctcaatgat
cagacagcaaagctttttgtgagaccaagaggttggcatctacctgaagcacatattctg
attgatggtgaacctgcaactggttgccttgttgattttggcctctatttctaccacaac
cactcggcattccgacgcactcaaggtgctggctttggccctttcttttatcttcccaaa
atggagcattcaagggaagctaagatatggaacagtgtgtttgagaaggctgaggatgta
gcaggcattgaaagaggaagcataagggcaacggttctgatagaaacacttcctgcagtg
tttcaaatggatgaaattctatatgagctgaaagagcattcggtgggtctaaactgtggg
cgttgggattacattttcagttatgttaaaaccttccagactcacccagatcgtctacta
ccagacagggtccaggttggcatgactcaacatttcatgaagagttactctgatctcctc
atcaggacatgccacaggcgcggtgtgcatgctatgggaggaatggcagcacagattcca
atcaaagatgacccagttgcaaatgaggcagcactggaacttgtaaggaaggacaagctt
agagaagtgaaggcaggccacgatggaacttgggctgcacatcctggtctcattccatcc
tgcatggaggttttcaacaacaacatgggcaatgctcccaaccagatagacacagtgaaa
cgcgatgatgctgcaaacttaactgaacaagacctcttgcagataccaacaggaacccgg
accatggaaggtctcagattgaatacaagggtgggcattcagtacttggcagcatggctc
agcggaagcggttgcgtgcctctttacaacctcatggaagatgctgccactgctgagatt
agcagggtgcagaactggcagtggctcaagtatggagtggagctagatggggatgggctt
ggagagaaagtgaacaaagacctttttcatagagtggttgaagaagagatggctaggatt
gaaaaggaagtgggaacagagaagttcgagaagggaatgtacaaggaggcttgcaagatc
ttcactcgccaatgcacgtccctaacacttgatgattttctcactttggatgcctataat
tacatagtcgtgcatcaccccaaggaaggaaccgtcaaagcttcgaactaa

DBGET integrated database retrieval system