KEGG   Glycine max (soybean): 100783003Help
Entry
100783003         CDS       T01710                                 

Definition
(RefSeq) beta-fructofuranosidase, cell wall isozyme-like
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
gmx  Glycine max (soybean)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100783003
   00500 Starch and sucrose metabolism
    100783003
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     100783003
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
13
AA seq 574 aa AA seqDB search
MAISPILLLAILSLIYGNGVLPIEATHHVYRNLQTLSSDSSDQPYRTAYHFQPRKNWIND
PNGPMRYKGLYHLFYQYNPKGAVWGNIVWAHSISNDLVNWTPLDHAIYPSQPSDINGCWS
GSATILPRGKPAILYTGINPNKHQVQNLAIPKNMSDPLLREWVKSPKNPLMAPTISNNIN
SSSFRDPTTAWLGKDGYWRVLIGSKIHTRGMAILYKSKNFVNWVQAKQPLHSAEGTGMWE
CPDFYPVLDNKGPSTIGLDTSVNGDNVRHVLKVSLDDTKHDHYLIGTYDIAKDIFTPDNG
FEDSQTVLRYDYGKYYASKTIFEDGKNRRVLLGWVNESSSVPDDIKKGWAGIHTIPRAIW
LHKSGKQLVQWPVVELESLRVNPVHWPTKVVKGGEMLQVTGVTAAQADVEISFEVNEFGK
AEVLDKWVDPQILCSRKGAAVKGGLGPFGLLVFASRGLQEYTAVFFRIFRYQNKNLVLMC
SDQSRSSLNKDNDMTTYGTFVDMDPLHEKLSLRTLIDRSVVESFGGEGMACITARVYPTI
AINKKAQLYVFNNGTAAVKITRLSAWSMKKAKIN
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggccatatctccaattttgttgttggctatcttatctctcatttatggcaatggtgtt
cttcccattgaagctacccatcatgtttacagaaatcttcagactctatcttctgattcc
tctgatcaaccttatagaactgcttaccatttccaacctcgcaaaaattggataaatgac
cctaatggaccaatgaggtacaaaggactttaccatctgttctatcaatacaatccaaaa
ggtgccgtatggggcaatattgtctgggcccactcaatatcaaatgatcttgtgaattgg
actccactggatcatgccatctacccttctcaaccgtctgatataaacggttgttggtca
ggctcagccacaatactccctcggggcaagccagccattttatacacaggaattaaccct
aataagcaccaagttcaaaacttagccatacccaaaaacatgtctgacccattacttagg
gaatgggttaagtcacccaaaaatccactaatggcaccaactatttctaacaatatcaat
tcaagctcatttagggaccctaccactgcttggctaggaaaagatggatactggagggtg
ctgattggaagcaaaatacacactaggggtatggcaattttgtacaagagcaaaaacttt
gttaattgggttcaagccaaacaacccctacattcagctgaaggcactggaatgtgggag
tgccctgatttctatccagtgctggataataagggcccatcaactattggtcttgacaca
tctgtgaatggtgataatgttaggcatgtgcttaaggttagtttggatgatacaaaacat
gatcattatttgattgggacttatgacattgccaaggatatcttcactccggataacgga
tttgaggatagccaaactgtcttaagatatgactatggaaaatattatgcctcaaaaacg
atttttgaagatggaaaaaacagaagggtcttattgggttgggttaacgaatcctcaagt
gttccggatgatatcaagaaaggatgggctggaatccataccattccaagggccatctgg
cttcataaatctgggaaacagttggtgcaatggccggtggtggaacttgaaagcttgcgt
gtgaaccctgtccactggcccaccaaagtggtcaaaggtggtgaaatgcttcaagttact
ggtgtcactgcggcacaggctgacgttgaaatttcatttgaagtgaatgagtttggaaag
gccgaagtattggacaaatgggtggatccccaaattctgtgtagtagaaagggggcagcc
gtaaagggtggtttgggaccctttggcttgctagtttttgcttctcgtggcttacaagag
tacacggcagtgttctttagaatattcagataccaaaataaaaatttggttctcatgtgt
agcgaccaaagcagatcctctttgaataaagataacgatatgaccacctatgggactttt
gtggacatggaccctcttcatgagaagctgtcgctaagaactttgattgatcgctcagta
gtggagagttttggaggagagggaatggcttgcatcacagccagagtatatcccacaata
gcaattaataaaaaggcacaactatatgttttcaataatggaactgccgctgtcaagatc
acaagattgagtgcttggagcatgaagaaggcaaaaatcaactga

DBGET integrated database retrieval system