KEGG   Glycine max (soybean): 100783178Help
Entry
100783178         CDS       T01710                                 

Definition
serine/threonine-protein phosphatase PP1-like
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
gmx  Glycine max (soybean)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    100783178
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100783178
Protein phosphatases and associated proteins [BR:gmx01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     100783178
Transcription machinery [BR:gmx03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100783178
Spliceosome [BR:gmx03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100783178
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 321 aa AA seqDB search
MDENLLDDIIRRLVAAKNGRTTKQVQLTEAEIRQLCVSSKEIFLSQPNLLELEAPIKICG
DVHGQYSDLLRLFEYGGYPPEANYLFLGDYVDRGKQSIETICLLLAYKIKYKENFFLLRG
NHECASINRIYGFYDECKRRFNVRLWKTFTDCFNCLPVAALIDEKILCMHGGLSPDLKHL
DQIRSIARPIDVPDHGLLCDLLWADPDKDLDGWGENDRGVSFTFGADTVVEFLEHHDLDL
ICRAHQVVEDGYEFFAKRQLVTIFSAPNYCGEFDNAGAMMSVDDALTCSFQILKSSEKKG
KGGFGINTSRPGTPPHKGGKN
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggacgagaacctgctcgacgatattatccggaggctcgtcgcggcgaagaacggtaga
acgacgaagcaggtgcagcttacggaggcagaaattcgacaactctgtgtttcctccaaa
gagatctttctcagtcaacctaatcttctcgaactcgaggctcctattaagatttgtgga
gatgttcatggccaatactcagatcttttaaggttgttcgaatatgggggatacccacct
gaagcaaattatttatttctcggagattatgttgatcgtggtaagcagagcatagagaca
atatgtttactcctcgcctacaagatcaaatacaaggagaatttctttcttctcaggggc
aaccatgagtgtgcatccatcaatcgtatatatggtttctatgatgagtgtaagaggagg
tttaatgttcgcctctggaagacatttactgattgctttaattgccttcctgtcgctgct
ctgatagatgagaagatcctttgcatgcatggtggactatcgcctgatcttaaacacttg
gatcagattcgaagtattgctcgtcctattgatgtgccagatcatggccttctatgtgac
cttctatgggctgatcctgataaagatcttgatgggtggggagaaaatgaccgaggtgta
tcatttacatttggggctgacaccgttgttgaatttcttgaacatcatgatctcgatctg
atttgcagagctcaccaggttgtagaggatggatatgagttttttgccaagcgtcagctg
gtgacgatattctccgcaccaaattactgcggtgaatttgataatgctggtgctatgatg
agtgtggatgacgccttgacatgctctttccaaatacttaaatcttctgaaaagaaaggg
aaaggtggatttggcatcaacacatcaagaccaggaactccaccccataagggtgggaag
aattaa

DBGET integrated database retrieval system