KEGG   Glycine max (soybean): 100783318Help
Entry
100783318         CDS       T01710                                 

Definition
(RefSeq) alcohol dehydrogenase
  KO
K18857  alcohol dehydrogenase class-P [EC:1.1.1.1]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00010  Glycolysis / Gluconeogenesis
gmx00071  Fatty acid degradation
gmx00350  Tyrosine metabolism
gmx00592  alpha-Linolenic acid metabolism
gmx01100  Metabolic pathways
gmx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100783318
  Lipid metabolism
   00071 Fatty acid degradation
    100783318
   00592 alpha-Linolenic acid metabolism
    100783318
  Amino acid metabolism
   00350 Tyrosine metabolism
    100783318
Enzymes [BR:gmx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     100783318
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C UDPG_MGDP_dh_N 2-Hacid_dh_C IlvN TrkA_N
Motif
Other DBs
NCBI-GeneID: 100783318
NCBI-ProteinID: XP_003523232
UniProt: I1JY29
Position
4
AA seq 381 aa AA seqDB search
MASTTAGKVIRCKAAVAWEAGKPLVIEEVEVAPPQANEVRIKILFTSLCHTDVYFWEAKG
QTPLFPRIFGHEAGGIVESVGEGVTDLKPGDHVLPVFTGECKECDHCKSEESNMCDLLRI
NTDRGVMLNDGKARFSINGQPIYHFVGTSTFSEYTVVHVGCVAKINPAAPLDKVCVLSCG
ISTGLGATLNVAKPNKGSSVAVFGLGAVGLAAAEGARLAGASRIIGVDLNSKRFTEAKKF
GVTEFVNPKDYDKPVQEVIAEMTGGGVDRSVECTGSINAMISAFECVHDGWGVAVLVGVP
NKDDAFKTHPINVLNEKTLKGTFFGNYKPRSDLPSVVEMYMNKELELEKFITHEVPFEEI
NKAFEYMLKGESLRCIIRMTE
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaaccactgctggaaaggtcatacgctgcaaagctgcggtagcatgggaagct
ggaaagccattggtgatagaagaagttgaggtagctccaccacaggcaaatgaggttcgt
atcaagatcttgttcacctcactctgccacactgatgtctacttctgggaagccaaggga
cagacacctttatttccacggatatttggtcacgaagcaggaggaattgtggaaagtgtt
ggtgagggtgtgacggatctcaagcccggtgatcatgtgcttccagtcttcactggggag
tgcaaggagtgtgatcattgcaaatcagaagaaagtaacatgtgtgacctcctaaggatt
aacaccgaccgtggagtgatgctgaatgatggcaaggcaaggttttcaatcaatggacaa
ccaatataccactttgtgggaacctccactttcagtgagtacactgtagtccatgttggt
tgtgttgccaagatcaaccctgctgccccacttgacaaagtttgtgttctgagctgtgga
atctcaacaggtcttggtgctacattgaatgttgcaaaaccaaacaaaggttcatcagtg
gctgtatttggattgggagccgtggggcttgctgctgccgagggagctagacttgctggt
gcttccaggataattggggttgacttgaattctaagagatttactgaagctaagaagttt
ggagttaccgagtttgtgaatccaaaagattatgacaagccagttcaagaggtgattgct
gaaatgactggtgggggagttgaccgaagtgttgagtgcactggaagtatcaatgctatg
atctctgcattcgaatgtgtgcatgatggatggggtgttgctgtacttgttggtgtgcca
aataaagatgatgctttcaaaactcatccaattaatgtcttgaacgaaaagactctcaag
ggtactttctttggcaactataaaccacgttctgaccttccatcagtggtggagatgtat
atgaacaaggaacttgaactggagaaatttatcacccatgaagtacctttcgaagaaatc
aacaaagcttttgaatacatgcttaaaggggagagcctgcgttgcataatccgcatgact
gaatag

DBGET integrated database retrieval system