KEGG   Glycine max (soybean): 100783814Help
Entry
100783814         CDS       T01710                                 

Definition
uncharacterized LOC100783814
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
gmx  Glycine max (soybean)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100783814
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     100783814
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18
AA seq 467 aa AA seqDB search
MGCVIDGRFTVEIQNGVSNGCGEVGLWNDGGGAIEDAVKVLLEGLGEDVNREGLRKTPLR
VAKALHEGTRGYRQKVNDIVQGALFPEAGLDNRVGHAGGAGGLVIVRDLDLFSYCESCLL
PFPVKCHVGYVPSGERVVGLSKLSRVADVFAKRLQEPQRLADEVCSALHQGIRPAGVAII
LQCSHIHFPDIESVFLDSNYQGWVKILVSSGSGVFENKNADVWADFFGLLKFRGINMDKI
HFRGSSDPCWCPSQSSLSAKVSSKIGPVNPVMVTAVASVIESLGENPLRKELIGTPTRFV
KWLMNFQKSNFNIKLNGFLCDGIDSLNVNEDVNINKKITSELNIPFWSQCEHHLLPFHGV
VHIGYLMSDGFNPILKSLLQSIVHFYGFKLQVQERLTRQIAETIAPLLGGDVIVVVEASH
TCMISRGIEKFGSSTATIGVLGHFSTDPTARASFLKSIPYPTSSGEQ
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggggtgtgtgattgatgggcgtttcactgttgagattcaaaatggagtgagcaatggt
tgtggtgaagtgggtttgtggaatgatggtggtggtgccattgaggatgctgtgaaggtt
ttgttggagggtctaggggaagatgtgaacagggaaggccttagaaagacaccacttcgt
gtagccaaggcccttcatgaaggaaccagaggttacagacaaaaggtgaacgacattgtt
caaggtgctttattccctgaagctggtctagataatagagttggtcatgcaggtggagca
ggtggacttgtgattgttcgagatcttgacttgttttcctattgcgagtcctgcttgctt
ccattcccggtcaagtgtcatgtgggttatgtcccctctggtgaaagagttgttggttta
agcaagctctctcgtgttgctgatgtatttgcaaaacgacttcaagagcctcagcgtctg
gcagatgaggtgtgttctgctttacatcagggaataaggccagcaggtgttgctatcata
cttcaatgttcacatatccactttccagacatagaatcagtctttcttgactcaaattat
caagggtgggtgaagatacttgtttcttcaggttctggggtttttgagaacaaaaatgca
gatgtatgggctgatttctttggtcttcttaaatttagaggcatcaatatggataaaatt
cattttagaggatcatctgatccatgctggtgtccttctcagtcttctctctctgccaaa
gtttcctccaaaataggaccagtcaatcctgtaatggttactgcagtagcttcagttatt
gaatctttgggagaaaatcctttgaggaaggagcttatagggactccaactagatttgtg
aaatggttgatgaactttcaaaagagtaactttaatatcaagttgaatggttttctttgt
gatgggatagattctttaaatgtcaatgaggatgttaacatcaacaaaaaaataacctct
gagttgaacatacctttttggtcacaatgtgagcatcatttgcttccttttcatggtgtt
gttcacataggataccttatgtctgacggattcaatcctatcttaaaatcgcttttacaa
tcaattgtacatttttatggtttcaagctccaagttcaggaaaggcttaccaggcagata
gctgaaaccattgccccactgttaggtggagatgtgatagtagttgtagaggcaagccac
acgtgtatgatttcgaggggaattgagaagtttggaagtagtacggctactattggtgtg
ttaggacatttttcaaccgaccctactgcaagggcatcattcttgaagagtattccatat
cctacatcatctggggagcaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system