KEGG   Glycine max (soybean): 100783905Help
Entry
100783905         CDS       T01710                                 

Definition
beta-galactosidase 17-like
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
gmx  Glycine max (soybean)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:gmx00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:gmx00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:gmx00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:gmx00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:gmx00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 708 aa AA seqDB search
MRIGLKKKKTTSGAASKLLAMAKKLSSKPTILFIFVSFMLFCAFLPVFAPLPSFSSHHSH
RNTVNRKFEIANDRFWKDGEPFQIIGGDVHYFRVHPEYWEDRLLKAKALGLNTIQTYVPW
NLHEPAPGKLVFEGFANIEAFLNLCHKHGLLVMIRPGPYICGEWDWGGFPGWFYSMIPTP
KPRSSDPTYLQLVERWWGNLLPKFVPLLYENGGPIIMVQIENEYGSYGDDKEYLHHLITL
ARGHLGHDVILYTTDGGTRETLEKGTIRGDTIFSAVDFGTGEDPWPIFKLQKEFNAPGKS
PPLSAEFYTGWLTHWGEKNAQTDADFTAAALEKILQKNGSAVLYMAHGGTNFGFYNGANT
GVDEADYKPDLTSYDYDAPIRESGDVDNSKFNAIRRVIARYSSVPLPSIPSNNEKARYGP
IHLQREAFVFDMFDFTNSTNVFKSETPMSMEYVGQLFGFVLYVTEYKAKRGGRILFIPKL
HDRAQVFISCPSEESGARPTYIGTIERWLNNKVTLPDIKCHSKINLFILVENMGRVNYGS
FIFDRKGILSSVYLDKEQVKGWKMFPIPLHNLNEMSTYNPITQVAYSAFSGISSFRKKLI
YKNGNTSKEPAFYSGHFLIDKSSQVKDTFISFNNWGKGIVFVNDFNIGRYWPLRGPQCNL
YVPAPLLKQGDNFLVILELESPDPELVVHTVDEPDFTCGSSGTSLHQL
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcggattgaagaagaagaagacgaccagcggtgcagcttcgaaattgctggcc
atggcgaagaagctaagctcgaagcccaccattttgttcatcttcgtctctttcatgctt
ttttgcgcctttcttcctgttttcgctcctcttccttctttctcctctcaccattctcat
cgcaatacagttaacagaaagttcgagatcgccaacgataggttctggaaagatggtgaa
ccatttcagatcatcggtggtgacgtgcattattttcgagtgcatccagagtactgggaa
gatagactgctaaaagccaaggcattgggcttgaacacaattcagacatatgttccttgg
aatctgcatgagcccgcaccgggaaagcttgtttttgagggttttgcaaacattgaagca
ttcctcaacctttgtcacaaacatggtctccttgtgatgattcgacccggaccatacata
tgcggagagtgggattggggcggtttcccaggttggttctattccatgatcccaaccccc
aaaccaagatcatctgatcctacttatcttcaactggttgaaagatggtggggtaacctg
cttccaaagtttgttcctcttctatatgaaaatggaggccctataataatggttcagatt
gaaaatgagtatggttcttatggagatgacaaagaatatctccatcacctgatcaccctg
gcaagaggtcatcttgggcatgatgttattttatacactacagatggaggcaccagggaa
actcttgagaaaggaaccattcgtggggataccatcttttcagctgttgactttggtact
ggtgaagatccttggcctatattcaagttacaaaaggagttcaatgccccaggaaaatca
ccacctttgtcagctgaattttacaccgggtggcttacacactggggagagaaaaatgct
cagactgatgctgattttacagcagctgctcttgaaaaaattttgcaaaaaaatggttct
gcagttctctatatggcccatggtgggacaaactttggattttataatggagcaaatact
ggtgtagatgaggctgactacaaacctgatctcacttcatacgattatgatgcaccaatt
agggaatctggtgacgttgacaattcaaaattcaatgctattcgaagggttatagccaga
tatagctcagtacctcttccatctattccctctaataatgaaaaggcaagatacggacca
attcacttacaaagagaggctttcgtatttgacatgtttgatttcaccaattccaccaat
gtgtttaaatctgaaaccccaatgtcaatggagtatgtgggccagttgtttggtttcgta
ttgtatgtcactgaatacaaagcaaagagaggtggaagaattttgttcataccaaagtta
catgacagagctcaagtatttatttcatgcccctctgaagaaagtggtgcaaggccaact
tacattggaactattgaaaggtggttaaataacaaagtaactcttccggatattaaatgc
cattctaagatcaacttatttattctggttgaaaacatgggtcgtgtaaattacgggtct
ttcatctttgataggaagggcattctgtcttctgtttatctggacaaggaacaagtaaaa
gggtggaaaatgttccctattcctttgcacaacctgaatgaaatgtcaacctacaatccc
atcacgcaagttgcatattctgcattcagtggcatatcatcattcagaaaaaagttgatt
tataagaatgggaatacttcaaaagaacctgctttttattcgggccacttcttaattgat
aaatcaagtcaggtcaaggatacatttatatcattcaacaattggggaaaaggcattgtg
tttgttaatgacttcaatataggaagatattggccgttgagaggaccacagtgcaacctc
tacgttcctgctccactccttaaacaaggagataactttttggtaatactagagttggaa
tctccagaccccgaacttgtggtgcacacagtggatgagccagacttcacatgtggctct
agtgggacgagtctccatcagctgtaa

DBGET integrated database retrieval system