KEGG   Glycine max (soybean): 100783973Help
Entry
100783973         CDS       T01710                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit J
  KO
K03245  translation initiation factor 3 subunit J
Organism
gmx  Glycine max (soybean)
Pathway
gmx03013  RNA transport
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100783973
Ribosome biogenesis [BR:gmx03009]
 Eukaryotic Type
  Pre-40S particles
   Other pre-40S particles
    100783973
Translation factors [BR:gmx03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100783973
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF3_subunit
Motif
Other DBs
NCBI-GeneID: 100783973
NCBI-ProteinID: XP_003534091
UniProt: I1L3W4
Position
9
AA seq 229 aa AA seqDB search
MDDWEDEHIAPIDLTLKDPVKTNWDDEDVDENDVKESWEDEDEPAPAPAAPAVKTTVKAP
KKSSDKDNDKKGKTVEPIKEEPLDPVAEKLRQQRLIEEADYKATKELFSGGNEKDEKNLD
TFIPKSESDFLEYAELISHKLRAFEKSYHYIGLLKAVMRLSTTSLKGADAKDIASSVTAI
ANEKIKAEKEANAGKKKIGGKKKQLNVDKPDEDFIPADRYDALDDYDFM
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggatgattgggaggatgagcatattgcccctattgatctaacattgaaagatccagtt
aaaactaattgggacgatgaagatgtggatgaaaatgatgtgaaggaatcatgggaggat
gaagatgagcctgctccggcacctgcagcacctgctgtgaaaactactgtaaaggctccc
aaaaaatcttctgataaagataatgacaagaagggtaagacagtagaaccaataaaggaa
gaaccattagatcctgtggctgaaaaacttcgccaacaaagattaattgaagaagcagat
tataaggccactaaagaattgttcagtgggggaaatgaaaaagatgaaaagaaccttgac
actttcataccgaaatctgaaagtgatttcttggagtatgcagagctcatctcacacaag
ctccgtgcttttgagaaaagttatcattatattggcttgctgaaggcagtaatgagacta
tcaacgacttctctaaaaggggcagatgccaaagatattgcatcttcggtaactgccatt
gcaaatgagaagataaaggcagaaaaagaagccaatgctggtaaaaagaagataggtgga
aagaaaaaacaacttaatgttgataaacctgatgaggattttattcctgctgatcgatat
gatgctctggatgattatgatttcatgtga

DBGET integrated database retrieval system