KEGG   Glycine max (soybean): 100784140Help
Entry
100784140         CDS       T01710                                 

Definition
(RefSeq) 40S ribosomal protein S11
  KO
K02949  
small subunit ribosomal protein S11e
Organism
gmx  Glycine max (soybean)
Pathway
Ribosome
Module
Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    100784140
Ribosome [BR:gmx03011]
 Ribosomal Proteins
  Eukaryotes
   Small subunit
    100784140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
17
AA seq 159 aa AA seqDB search
MAEQTEKAFLKQPKVFLSSKKTGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP
FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHFIKKYQRYEKRHSNIPAHISPAFRVKE
GDHVIIGQCRPLSKTVRFNVLKVIPAGSSSGAKKAFTGM
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcaaaccgagaaggcttttttgaaacaaccaaaagtgtttctcagctcgaag
aaaactgggaagggaaagagacccggaaagggtgggaaccgcttttggaaatccattggg
cttggatttaagactcccagggaagccatcgaaggaacctacattgacaagaagtgcccc
ttcactggcaatgtttccatccgtggccgtatcttggctggaacatgtcacagtgctaag
atgaacaggactattattgttaggaggaattatctccattttatcaagaagtaccagagg
tacgagaaaaggcactccaacattcctgctcatatatcacctgctttccgtgtgaaggaa
ggagatcacgttattattggtcaatgcaggccactttctaagactgtgaggttcaatgtg
ttgaaagtgatcccagctggatcttctagcggtgcaaagaaggcttttactggaatgtga

DBGET integrated database retrieval system