KEGG   Glycine max (soybean): 100784140Help
Entry
100784140         CDS       T01710                                 

Definition
40S ribosomal protein S11-like
Orthology
K02949  
small subunit ribosomal protein S11e
Organism
gmx  Glycine max (soybean)
Pathway
Ribosome
Module
Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    100784140
Ribosome [BR:gmx03011]
 Ribosomal Proteins
  Eukaryotes
   Small subunit
    100784140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
17
AA seq 159 aa AA seqDB search
MAEQTEKAFLKQPKVFLSSKKTGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP
FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHFIKKYQRYEKRHSNIPAHISPAFRVKE
GDHVIIGQCRPLSKTVRFNVLKVIPAGSSSGAKKAFTGM
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcaaaccgagaaggcttttttgaaacaaccaaaagtgtttctcagctcgaag
aaaactgggaagggaaagagacccggaaagggtgggaaccgcttttggaaatccattggg
cttggatttaagactcccagggaagccatcgaaggaacctacattgacaagaagtgcccc
ttcactggcaatgtttccatccgtggccgtatcttggctggaacatgtcacagtgctaag
atgaacaggactattattgttaggaggaattatctccattttatcaagaagtaccagagg
tacgagaaaaggcactccaacattcctgctcatatatcacctgctttccgtgtgaaggaa
ggagatcacgttattattggtcaatgcaggccactttctaagactgtgaggttcaatgtg
ttgaaagtgatcccagctggatcttctagcggtgcaaagaaggcttttactggaatgtga

DBGET integrated database retrieval system