KEGG   Glycine max (soybean): 100784140Help
Entry
100784140         CDS       T01710                                 

Definition
(RefSeq) 40S ribosomal protein S11
  KO
K02949  small subunit ribosomal protein S11e
Organism
gmx  Glycine max (soybean)
Pathway
gmx03010  Ribosome
Module
gmx_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    100784140
Ribosome [BR:gmx03011]
 Ribosomal Proteins
  Eukaryotes
   Small subunit
    100784140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_S17_N Ribosomal_S17
Motif
Other DBs
NCBI-GeneID: 100784140
NCBI-ProteinID: XP_003549708
UniProt: I1MU00
Position
17
AA seq 159 aa AA seqDB search
MAEQTEKAFLKQPKVFLSSKKTGKGKRPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP
FTGNVSIRGRILAGTCHSAKMNRTIIVRRNYLHFIKKYQRYEKRHSNIPAHISPAFRVKE
GDHVIIGQCRPLSKTVRFNVLKVIPAGSSSGAKKAFTGM
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcaaaccgagaaggcttttttgaaacaaccaaaagtgtttctcagctcgaag
aaaactgggaagggaaagagacccggaaagggtgggaaccgcttttggaaatccattggg
cttggatttaagactcccagggaagccatcgaaggaacctacattgacaagaagtgcccc
ttcactggcaatgtttccatccgtggccgtatcttggctggaacatgtcacagtgctaag
atgaacaggactattattgttaggaggaattatctccattttatcaagaagtaccagagg
tacgagaaaaggcactccaacattcctgctcatatatcacctgctttccgtgtgaaggaa
ggagatcacgttattattggtcaatgcaggccactttctaagactgtgaggttcaatgtg
ttgaaagtgatcccagctggatcttctagcggtgcaaagaaggcttttactggaatgtga

DBGET integrated database retrieval system