KEGG   Glycine max (soybean): 100784256Help
Entry
100784256         CDS       T01710                                 

Gene name
CHLI
Definition
magnesium-chelatase subunit chlI, chloroplastic-like
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
gmx  Glycine max (soybean)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100784256 (CHLI)
Enzymes [BR:gmx01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     100784256 (CHLI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 421 aa AA seqDB search
MASALGTSSIAVLPSRYFSSSSSKPSIHTLSLTSGQNYGRKFYGGIGIHGIKGRAQLSVT
NVATEVNSVEQAQSIASKESQRPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGT
GKSTTVRSLVDLLPEIKVVAGDPYNSDPQDPEFMGVEVRERVLQGEELSVVLTKINMVDL
PLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAA
SGWNTVEREGISISHPARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVE
ERGRFDKNPKEFRDSYKAEQEKLQQQITSARSVLSSVQIDQDLKVKISKVCAELNVDGLR
GDIVTNRAAKALAALKGRDNVSAEDIATVIPNCLRHRLRKDPLESIDSGLLVTEKFYEVF
S
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccgccttgggcacttcttcaattgcggttctgccttcgcgctacttctcttct
tcttcttccaagccttccattcacactctctctctaacttcagggcagaactatgggcgg
aagttttatggaggaattggaatccatggcataaagggaagggctcagctctcggttacc
aatgttgccactgaagttaactctgtagaacaggctcagagtattgcttctaaagaaagc
cagaggccagtatacccattttctgccatagttggacaagatgagatgaagctttgtctt
ctccttaatgtgattgatcctaagattggaggtgtaatgatcatgggggataggggcaca
gggaaatctacaacggtcaggtcattggttgatttacttcccgaaatcaaggttgttgct
ggtgacccttataactcagacccacaagatccagaattcatgggtgttgaagtcagagag
cgtgtacttcaaggagaggaactttctgttgtcttgaccaaaattaacatggttgatttg
ccattgggagctacagaagatagagtgtgtggaacgattgacattgagaaagccctgact
gagggtgtcaaggcatttgagcctggactactggctaaagctaataggggaatcttatat
gttgatgaagttaatcttttggatgatcacttggtggatgtgttgttggattctgctgca
tcaggatggaacacagtagagagagagggaatttctatctcgcatcctgcacggtttatc
ctaattggctcaggcaaccccgaagaaggggagctccggccgcagctgctagataggttt
ggaatgcatgctcaagttggaactgttagggatgctgagctcagagtgaagattgtggag
gagagaggtcgatttgacaaaaatccaaaggaatttcgagattcttacaaagctgagcaa
gagaagctccaacaacaaattacctcagcaaggagtgttctttcttctgttcaaattgat
caagatctcaaggtgaaaatctccaaggtgtgtgctgagttgaatgtggatggattaaga
ggagacatagtaacaaatagagctgcaaaagctctggctgctctgaagggaagagacaac
gtaagtgccgaggatattgctactgtcatccctaactgcttgagacaccgtcttagaaag
gatcccttggagtctatagactcaggtttacttgtcactgagaaattttatgaggtattc
agctga

DBGET integrated database retrieval system