KEGG   Glycine max (soybean): 100784534Help
Entry
100784534         CDS       T01710                                 

Definition
(RefSeq) phosphoinositide phospholipase C 2-like
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00562  Inositol phosphate metabolism
gmx01100  Metabolic pathways
gmx04070  Phosphatidylinositol signaling system
gmx04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100784534
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    100784534
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100784534
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100784534
Membrane trafficking [BR:gmx04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100784534
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100784534
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y C2 EF-hand_like
Motif
Other DBs
NCBI-GeneID: 100784534
NCBI-ProteinID: XP_003552353
UniProt: I1MZ21
Position
18
AA seq 592 aa AA seqDB search
MPSKQTYSFCFCFRRRFRLPVSEAPPEIRTLFDRYSDQNGVMTATHLRSFLAEVQREDNA
TEEEAQTIIDGHKHLSIFHRRGLNLESFFNYLFSHHNNPPLSPSIGVHQDMSSPLSHYFI
YTGHNSYLTGNQLSSDCSDIPIINALQKGVRVIELDIWPNESKDNVDVLHGRTLTSPVAL
IKCLRSIKQHAFVASEYPVVITLEDHLTPDLQAKVAEMITRTFGDILFAPTSKSLKEFPS
PESLKRRVIISTKPPKEYLEAKEVQETEEGPQQEKPADDEEAWGKEVPSLRGGTISDYKN
IEDDDVLDDEEDIDEAEKSRQDAADEYRRLIAIHAGKPKGGLTECLKVDPDKVRRLSLSE
LQLEKAAETHGKEIVRFTQRNILRVYPKGTRITSTNYNPLIGWMHGAQMVAFNMQGYGRS
LWLMQGMFKANGGCGYVKKPDFLLKVGQNNEVFDPKAHLPVKTTLKVTIYMGEGWFHDFK
HTHFDKFSPPDFYARVGIAGVPNDTVMKKTEKVEDNWSPSWNQVFEFPLAVPELALLRVE
VHEYDMSEKDDFGGQTCLPVWELRSGIRAVPLYSRNGDKYANVKLLMRFEFI
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgcctagcaaacagacttatagcttttgcttctgcttccgccggcgtttcaggctcccc
gtgtcggaggccccgccggagataaggacccttttcgaccgttactccgatcagaatggc
gtcatgacagccactcacctccgaagtttcctggctgaggtgcagagggaagacaatgcc
actgaggaggaagcacaaaccatcatcgatggccacaagcatctcagtatctttcaccga
agaggtctcaatctcgagagtttcttcaactatctttttagtcaccataataacccacct
ctctcgccctctattggggtgcaccaagatatgtcttcacctttgtctcattacttcatt
tatactggtcataattcctatctaactgggaaccagcttagcagtgactgcagtgacatc
cccatcatcaatgcactgcagaagggcgtaagggtgattgagttagatatatggcctaat
gaatcaaaggataatgtggatgttcttcatggaaggactttgacatctcctgtggcactc
atcaaatgtttgaggtctattaagcagcatgcctttgttgcctcagaatatccagttgta
ataaccttagaagaccatctaactcccgaccttcaggccaaagtggctgagatgattact
cgaacatttggagacatattatttgctcctacctcaaaaagcttgaaggaatttccttct
cctgaatcacttaaaaggagggttattatatcaaccaaaccacctaaggagtaccttgag
gcaaaagaagtacaggaaacagaggagggaccacaacaggaaaagcctgcagatgatgaa
gaagcatgggggaaggaagtccctagtttgagaggtggaactatctctgattacaagaac
attgaggatgatgatgttcttgatgatgaggaagatattgatgaagcagagaagtcacgt
caagatgcagcagatgaatacagacgtttaattgccattcatgctgggaagcctaaaggt
ggattaacggaatgtctcaaagtggatcctgataaagtgagacgtctaagtttaagtgag
ctacagcttgaaaaggctgctgaaactcatggaaaagaaattgtcagatttactcaacgg
aatatactgagagtgtatccaaaaggtactcgcattacttcgacaaattataacccattg
attgggtggatgcatggagctcagatggttgcatttaacatgcaggggtatggtagatct
ctttggttgatgcagggaatgttcaaagccaatggcggatgcggttatgttaaaaaacca
gattttctattaaaggttggtcaaaataatgaggtctttgatcctaaagctcatttgcct
gtgaagacaaccttgaaggtgactatatatatgggggaaggatggtttcatgatttcaag
catacacactttgataaattctcacccccggacttctatgcaagagtgggaattgctgga
gtccctaatgatactgttatgaaaaaaactgagaaagtagaggataattggtcaccttcg
tggaatcaagtatttgagttcccacttgctgttccagaactggctctgcttcgcgtagaa
gttcatgagtatgacatgtctgagaaggatgactttggtggccaaacgtgcttacctgtg
tgggaactaagaagtggaattcgagcagttccactgtattcccgcaatggagataagtat
gccaatgtgaagcttctcatgcgctttgaattcatttga

DBGET integrated database retrieval system