KEGG   Glycine max (soybean): 100785344Help
Entry
100785344         CDS       T01710                                 

Definition
Pyruvate dehydrogenase [lipoamide] kinase-like
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
gmx  Glycine max (soybean)
Brite
Enzymes [BR:gmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     100785344
Protein kinases [BR:gmx01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   100785344
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15
AA seq 369 aa AA seqDB search
MAAKKACETFSKSLIEEVHRWGCLKQTGVSLRYMMEFGSKPTDKNLLISAQFLHKELAIR
IARRAIELENLPYGLSQKPAVLKVRDWYVDSFRDLRAFPNIKNVNDEQDFTEMIKAIKVR
HNNVVPTMALGVQQLKKRMDPKIVYEDLVEIHQFLDRFYMSRIGIRMLIGQHVELHNPNP
PPHVVGYIHTKMSPVEVARNASEDARAICCREYGSAPDVHIYGDPDFTFPYVPAHLHLMV
FELVKNSLRAVQERFMDSDKVAPPIRIIVADGIEDVTIKVSDEGGGIARSGLPKIFTYLY
STARNPLDEHSDLGIGDNVTMAGYGYGLPISRLYARYFGGDLQIISMEGYGTDAYLHLSR
LGDSQEPLP
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaaaaaggcatgtgagacattctcaaagtccttgattgaggaagtgcataga
tggggttgcttgaagcagacaggggtaagtctcaggtacatgatggaattcgggtccaaa
cccactgacaaaaatttgttgatctctgctcagtttcttcacaaggaacttgccattaga
attgccagaagggccattgagcttgagaatcttccctatggtttgtctcaaaaacctgct
gttttaaaggttagggattggtatgtggattctttccgtgatctcagagccttccccaac
atcaagaatgtgaatgatgaacaagatttcactgaaatgatcaaggccatcaaagtgagg
cacaacaatgtggtacccacaatggccttgggtgttcagcaattgaagaaacgtatggat
ccaaagattgtttatgaagatcttgttgagattcatcagtttctagaccgcttctacatg
tcaaggattggaatccgtatgcttatcgggcagcatgttgagttgcacaatcccaatcct
cctccccatgttgtgggctatatacatacaaaaatgtctcctgtggaggtagcaaggaat
gccagtgaggatgcacgtgctatatgttgtcgcgaatatggaagtgcccctgatgtgcat
atttatggagatcctgattttacttttccgtatgttccagctcacttgcatcttatggta
tttgagttggttaagaactcactgcgtgccgtacaagagcgttttatggattctgataaa
gttgcacctcccattagaataatagttgctgatggaatagaggatgttaccataaaggtc
tcagatgagggaggtggaattgcaagaagtgggttgcctaaaatttttacatatctatat
agtactgcgagaaacccattggatgagcattcggatcttggaataggtgataatgtgaca
atggctggatatggatatggtcttcctattagtcgtctatatgctcggtattttggaggt
gatcttcaaataatctctatggaaggatatggcactgatgcatatctccatttgtctcgt
ttgggagattcacaagaacctttgccctga

  All links  
No link information was found.   
DBGET integrated database retrieval system