KEGG   Glycine max (soybean): 100785968Help
Entry
100785968         CDS       T01710                                 

Definition
1,4-alpha-glucan-branching enzyme 2-1, chloroplastic/amyloplastic-like
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
gmx  Glycine max (soybean)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100785968
Enzymes [BR:gmx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     100785968
Exosome [BR:gmx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100785968
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
19
AA seq 868 aa AA seqDB search
MVYTISGIRFPVLPSLHNSRFRGDRRTASLPVFLRNNSFSRKTLALKSSHDSDSLSSAIA
KSDKVLIPQDQDNSASLTDQLETPDITSEDTQNLEDLTMEDEDKYNISEAASSYRHIEDG
QGSVVSSLVDVNIPAKKASVSVGRKSKIVSDEVKPKIIPPPGTGQKIYEIDPSLLAHRDH
LDFRYGQYKRLCYEIDKHEGGLDTFSRGYEKFGFIRSATGITYREWAPGAKSAALIGDFN
NWNPNADVMTRNEFGVWEIFLPNNVDGSPPIPHGSRVKIRMDTPSGIKDSIPAWIKFSVQ
APGEIPYSGIYYDPPEEEKYVFKHPQPKRPKSLRIYESHIGMSSPEPKINTYVNFRDDVL
PRIKRLGYNAVQIMAIQEHSYYASFGYHVTNFFAPSSRFGTPEELKSLIDRAHELGLLVL
MDIVHSHASNNTLDGLNMFDGTDGHYFHPGSRGYHWMWDSRLFNYGSWEVLRYLLSNARW
WLDEYKFDGFRFDGVTSMMYTHHGLEVAFTGNYNEYFGFATDVDAVVYLMLTNDVIHGLF
PEAVTIGEDVSGMPTFCLPTQDGGIGFDYRLHMAIADKWIEILKKNDEDWKMGDIIHTLT
NRRWLEKCVAYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPIIDRGIALHKMIRL
ITMGLGGEGYLNFMGNEFGHPEWIDFPRGDQHLPNGVVVPGNNNSFDKCRRRFDLGDADY
LRYQGMQEFDQAMQHLEEKFGFMTAEHQYISRKNEGDKIIVFERGNLIFVFNFHWTNSYS
DYRVGCSTPGKYKIVLDSDDALFGGFSRLNHAAEYFTSEGWYDDRPRSFLIYAPSRTAVV
YALADEAEPALADATEPEPVDLDDKLLG
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atggtttacaccatctcgggaattcgatttccggttcttccttcgctgcacaactcccgc
ttccgtggcgatcgcagaactgcgtctcttcccgtttttctcagaaacaactccttctct
cgtaaaacccttgctctaaaatcttcccatgattctgattccttgtcttctgcgattgcc
aaatctgataaagtacttattcctcaagatcaagataactctgcatccttgacagatcaa
cttgaaactcctgatataacctcagaggatacacagaacttagaggatttaaccatggaa
gatgaggataaatacaacattagtgaagcagctagcagttacagacatattgaagatgga
caaggctctgttgtatcatcacttgtagatgtgaacattccggccaagaaagcgtcggta
tctgttggtaggaaatcaaagatagtaagtgatgaagttaaacctaagatcattccccca
cctggcactggacagaaaatatatgagatagatccatctttgctagctcaccgtgaccat
cttgatttccgttatggacaatacaaaagattgtgttatgaaattgacaagcatgaaggc
ggtctggatacattttctcgtggttatgaaaaatttggcttcatacgcagtgctacaggc
attacttacagagagtgggcacctggagctaagtcagcagcattaattggagacttcaac
aattggaatccaaatgcagatgtaatgaccaggaatgaatttggtgtgtgggagatcttc
ttgccaaacaatgtggatggttcaccaccaattccccatggttctcgggtcaagatccgc
atggatactccctctggaatcaaggactcaattcctgcttggattaagttttctgtacag
gctcctggtgaaattccatacagcggaatatactatgatcccccagaagaggaaaaatat
gtcttcaaacatccacagccaaagagaccaaaatcacttagaatatatgagtcacacatc
ggaatgagcagtccggagccaaaaatcaatacatatgtcaattttagagatgatgtactg
cctcgcattaaaaggcttggctataatgctgtccagattatggctatccaagaacattct
tattatgccagctttgggtaccatgttacaaatttctttgcacctagcagccgatttgga
actccagaggaacttaagtctctgatagacagagcccatgaactgggtctgcttgttctg
atggatattgtacacagccatgcatcaaataatacattggatgggctgaacatgtttgat
ggaactgatggtcattacttccatcctgggtcacgaggttatcattggatgtgggattct
cgcctttttaactatggaagctgggaagttctaaggtatctactttcgaatgcacgatgg
tggctggatgaatacaagtttgatggatttcgatttgatggtgttacatcaatgatgtac
acacatcatggattggaggtagcatttactggaaattacaatgagtattttggttttgca
actgatgttgatgctgtggtttacctgatgctgactaatgatgtcattcatgggctcttc
cctgaggctgttacaattggtgaagatgtgagtggaatgcctacattctgccttcctaca
caagatggtgggattggctttgattatcgcctgcacatggccattgcagacaagtggatt
gagattctcaagaagaacgatgaagactggaaaatgggtgatatcatccacacattaaca
aacagaaggtggctggaaaaatgtgtagcttatgctgaaagtcatgaccaggccttggtt
ggtgacaagacaattgcattctggttgatggacaaggatatgtatgacttcatggcttta
gacagaccatccactcctattatagatcgtggtatagcgttgcacaaaatgattaggctt
attaccatgggccttggtggtgaagggtatttaaattttatggggaatgaattcggccat
cctgagtggattgatttcccaaggggtgatcaacatcttcctaatggcgtagtagttcca
gggaataacaacagttttgacaagtgcaggcgtagatttgacttgggcgatgcggactat
ctaagatatcaagggatgcaagaatttgatcaggctatgcagcacctagaagaaaagttt
ggtttcatgactgctgagcaccagtatatttcacggaaaaatgaaggtgacaaaattata
gtcttcgaaaggggcaacctcatctttgtcttcaattttcattggaccaacagctattca
gattacagagttggctgctcaacccctgggaaatataagattgtcttggattcagatgat
gccttgtttggtggcttcagtaggctcaatcacgctgctgagtacttcacctcagaagga
tggtatgatgaccgacctcgatcctttcttatctatgcaccttctagaacagcagtggtt
tatgccctagcagatgaagctgaacctgccctagcagatgcaactgaaccagagccagtt
gatcttgatgacaagcttctgggatga

DBGET integrated database retrieval system