KEGG   Glycine max (soybean): 100786284Help
Entry
100786284         CDS       T01710                                 

Definition
mitogen-activated protein kinase kinase 6-like
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
gmx  Glycine max (soybean)
Pathway
Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Organismal Systems
  Environmental adaptation
   04626 Plant-pathogen interaction
    100786284
Enzymes [BR:gmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100786284
Protein kinases [BR:gmx01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   100786284
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 356 aa AA seqDB search
MKMKTKTPLKQLKLAVPAQETPITSFLTASGTFHDGDLLLNQKGLRLISEEKESRPSDGK
ELEFDFLLDDLETIKVIGKGSGGVVQLVRHKWVGRLFALKVIQMNIQEDIRKQIVQELKI
NQASQCPHVVVCYHSFYHNGVISLVLEYMDRGSLADVIKQVKTILEPYLAVVCKQVLQGL
VYLHNERHVIHRDIKPSNLLVNHKGEVKITDFGVSAMLASSMGQRDTFVGTYNYMSPERI
SGSTYDYSSDIWSLGMVVLECAIGRFPYIQSEDQQSWPSFYELLAAIVESPPPSAPPDQF
SPEFCTFVSSCIQKDPRDRLTSLELLDHPFIKKFEDKDLDLGILVGGLEPPVNFPR
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgaagacgaagacgccattgaagcagctgaagctcgcggttcctgctcaggaa
acccccatcacgtctttcctgactgcaagtggaacattccatgatggagatctactcttg
aatcagaaagggttgcgtcttatctctgaagaaaaagaatcacggccttcagatggtaag
gaactggaatttgacttcttgctggacgatcttgagaccatcaaagtaattggaaaaggc
agtggtggtgtggtacaacttgttcgccataagtgggttggaagattgtttgctttaaag
gttattcagatgaatatacaagaggatattcgaaaacagattgttcaggaactgaaaata
aatcaagcgtcacagtgtccacatgttgtagtttgctatcactcattctatcataatgga
gtaatatctcttgtgttagaatacatggatcgtggttctctagcagatgtaatcaaacaa
gttaaaacaattctggaaccatatcttgctgtggtttgtaagcaggtattgcaaggcctt
gtttacctgcacaatgaaaggcatgtaatacacagggacattaaaccatccaatctgtta
gttaatcacaaaggggaggtgaagattactgattttggtgttagtgctatgctggcaagc
tcaatgggccaaagagatacatttgttggaacttacaattacatgtcgccagaaagaatc
agtgggagtacttatgattatagcagtgacatctggagtttgggtatggtagtgcttgag
tgtgccataggacggtttccttatatacagtctgaagatcagcaaagctggcctagtttt
tatgagcttctggcagcaattgtggaaagccccccaccttctgctccacccgatcagttc
tcccctgagttctgtacattcgtgtcatcctgcatccaaaaggatcctcgggatagatta
acatcattggagctactggatcatcctttcataaaaaagtttgaagataaagatctagat
cttgggattttggtaggtggcttggaacctcctgtaaactttccgagataa

DBGET integrated database retrieval system