KEGG   Glycine max (soybean): 100786314Help
Entry
100786314         CDS       T01710                                 

Definition
(RefSeq) mitogen-activated protein kinase 13
Organism
gmx  Glycine max (soybean)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 100786314
NCBI-ProteinID: XP_003538034
UniProt: I1LKA0
Position
Un
AA seq 373 aa AA seqDB search
MENNGAESENPKGIPIHGGKYVRYNILGSHFQVYSKYAPPLQPVGRGAYGIVCCATNSET
KEGVAIKKIGNAFDNRIDAKRTLREIKLLCHMEHDNIIKIKDIIRPAERENFNDVYIVYE
LMDTDLHQIIQSNQSLTDEHCQYFLYQLLRGLKYIHSANVLHRDLKPSNLLLNANCDLKI
CDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILMEIVRREPLFP
GKDYVQQLALITELLGSPNDSDLGFLRSDNAKKYVKQLPHVEKQSFAERFPEMSPLAIDL
AEKMLVFDPSKRITVEEALNHPYMASLHEINEEPTCPTPFIFSFEQTILKEEDIKELIWK
ESLNFSQDHQMLE
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacaatggtgctgaatctgagaatccgaaagggattccaattcacggagggaag
tacgttcgctacaacatcttaggcagccatttccaagtctattccaagtacgctccccct
ctccaacccgttggtcgcggcgcatacggcatcgtttgctgtgcgacgaattcggagacg
aaagaaggagtggcgataaagaagattgggaatgcgtttgacaacaggatcgatgccaag
agaacgctcagggaaatcaagcttctctgtcacatggaacatgataacataattaaaata
aaggacataattcggccagcggagagggagaatttcaacgatgtttatattgtgtacgaa
ttgatggacaccgatctgcatcagattatacagtctaatcagtctctcaccgatgagcat
tgccagtacttcttatatcaactcttgcgaggattgaagtacatccactctgcaaatgtt
ttgcaccgagatctaaaaccaagcaatttacttctcaacgcaaactgtgatctcaagata
tgtgactttgggcttgccagaacaacctctgagaccgactttatgacagaatatgttgtc
actcgttggtacagagcccctgaattgctactaaactgttcagaatatactgcagctatt
gatatttggtcggttggttgcattttgatggagatagttagaagggagcctttatttcct
ggtaaagattatgtccaacagttggcccttataactgagttactaggttcaccaaatgac
tcggatcttggattcctcagaagtgataatgcaaagaaatatgttaagcagctcccacat
gtagaaaagcaatccttcgcagagcggtttcctgaaatgtcccccttagcaattgatctt
gctgagaaaatgctggtttttgatccctccaagcgcataactgtcgaggaagccctgaat
cacccctatatggcaagtcttcatgagatcaacgaggagcccacttgcccaactcctttc
atattttctttcgaacagacaattctcaaagaagaagatataaaggagctcatatggaag
gagtctctaaacttcagccaggatcatcagatgttggaatag

DBGET integrated database retrieval system