KEGG   Glycine max (soybean): 100786606Help
Entry
100786606         CDS       T01710                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 23-like
  KO
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.4.19.12]
Organism
gmx  Glycine max (soybean)
Brite
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100786606
Peptidases [BR:gmx01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100786606
Ubiquitin system [BR:gmx04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100786606
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
2
AA seq 901 aa AA seqDB search
MAETIVIQTEPPNPPDPSSSTTIATPLLSRNIVFLPVKKPFKGFSNDFHIETLNPSSSEP
RPSGSVAKKHDASEFSEYGLDPELSFGITFRRIGAGLRNLGNTCFLNSVLQCLTYTEPLA
AYLQSGKHKTSCHVAGFCALCAIQNHVSRALQSTGRILSPEDLVGNLRCISRNFRNARQE
DAHEYMVNLLECMHKCCLPSGIPSESPGAYEKSFVHKIFGGRLRSQVKCHQCSYCSNKFD
PFLDLSLEIFKADSLQKALSNFTAAEWLDGGEKEYHCQRCKQKVRALKQLTIHKAPYVLT
IHLKRFHAHDPGQKIKKKIQFGCALDLKPFVSGSYDGDVKYSLYGVLVHAGSSTHSGHYY
CYVRTSNNMWYTLDDNRVSHVSEREVLNQQAYMLFYVRDRKNIVPRKPVDIAKKENMKTN
VNGNRESSTSNHVLQEYPNGTIENKAEKDALVLQKHNVILAESLMQSKRHGSELSSKAQA
QNDSPDGLSVAKSELGCLSSLDHSGKDYSLPHNLKSLAAPVGEKNNLRYENVISKEGIKD
SPSIVPSSTNPQNGELTTDGKCQSPKKNLVKIVDVAAPQDSSTNMTNGICPKTSLIHPKV
NHQLGTSAIGSVCEKASSMTYEDLVGSQGLVLNESVNTSLNTASLNQKPVKKSKKKFLRY
QVSWMHLRPIFHYMVYLGPRKKNHKRSKRRTLGMKNPNKDKMDKLAFSSEDAKPVVFPLL
LSCSESKATKAGYRPGANFKSSDESLIENRAEGEFRKRIDHSCAVLASAAQIEIISGSGS
IVSQFEARQADSAQDSRRDQMHNGLMSMLSRGLEETVVARWDDIELPSSQHLESKNDKLV
SIGYVGDEWDEEYDKGKRKKIRGFKHSFGGPNLFQEIAVEKSKFKRAKFDQSCSGNPPFR
I
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaccatcgtgatccaaacggagcctccgaatccgccagatccttcttcgtcc
actactatcgccactcccttgttgtcgagaaacatcgtgtttcttcccgtcaagaagccc
ttcaagggtttctccaacgatttccacatcgaaaccctaaacccttcctcctccgagcct
cgaccctccggttccgtcgctaagaaacacgacgcttccgaattctccgagtacggcttg
gatccggagctcagcttcggaattaccttccgaagaataggagctggattgcgaaatctg
ggaaacacttgttttctgaactccgtattgcagtgtttgacatatacagaacctctagct
gcgtatctgcaaagtgggaagcataaaacttcatgccacgttgctggattttgtgctctg
tgtgcaatacagaatcatgttagtcgtgcactgcaatcgactgggagaatattatcccca
gaggatttggttgggaatctacgatgcatatcaagaaatttccgaaatgcaaggcaggaa
gatgcacacgagtatatggtgaacttacttgagtgtatgcataaatgttgcctgccttct
ggcataccaagtgaatcacctggtgcttatgagaaaagttttgttcataaaatttttggt
ggtcgtctcaggagtcaggtgaaatgccaccagtgttcttattgctccaacaaatttgat
cctttcttagatttaagtcttgaaatattcaaggcagattcattgcaaaaagcactttca
aattttacggctgcagaatggttggatggaggggagaaggagtaccattgtcaacggtgc
aaacagaaagttagggctctcaaacagctaacaattcataaggcaccttatgtgctaacg
atccacttaaagcggtttcacgcccatgatcctggacaaaagattaaaaagaagattcaa
tttggctgtgcactggacttgaaaccttttgtcagtggctcgtatgatggagatgtaaag
tactctctatatggcgttctggttcatgctggttccagcactcattctggacactattac
tgctatgttcgcacttcaaataacatgtggtataccttggatgacaaccgggtaagtcat
gtcagtgagcgggaagttttaaaccagcaagcatacatgttgttttatgttcgtgataga
aaaaatattgttccaaggaagcctgttgacattgctaagaaggaaaatatgaagactaat
gtgaatggaaatagagaatcttcaacttcaaaccatgtattgcaggaatatccaaatggt
accatcgaaaataaagccgagaaggatgctctagttctgcaaaagcataatgtcatatta
gcagaaagcttgatgcaaagtaaaagacatggatctgaactttcttccaaggcccaggca
cagaatgactcaccagatggactgtctgtagctaaatcagaacttggatgcttgtcatca
ttagatcactctggaaaagattatagtctccctcataatctgaaatctttggctgcacca
gttggagaaaaaaataatttgcgctatgagaatgtaatttcaaaagagggcattaaagat
tctccttcaatagtgccctcatccactaatccccagaatggtgaactcactactgatgga
aaatgtcagtctccgaagaaaaatcttgtcaagatagttgatgttgctgcacctcaagat
tcaagcacaaatatgaccaatggcatttgccctaagacatcactaattcatccgaaagtt
aaccatcagcttggaacttctgcaattggttcggtgtgtgagaaagcaagtagcatgacg
tatgaagatctggttggttctcagggactggttcttaacgagtcagtaaatacatctttg
aatacagcgagtcttaatcaaaagcctgtgaaaaaatcaaaaaagaagttccttaggtat
caggtatcttggatgcatcttcgcccaatcttccattacatggtatacttgggcccacgg
aagaagaatcacaaaagaagtaaacgccgcactttgggtatgaagaatccaaacaaagac
aagatggataagcttgctttctcatcagaagatgccaaacctgttgtatttcctttgtta
ttaagttgctctgaaagtaaagcaaccaaggctggttatagacctggtgctaattttaaa
tctagtgatgaatctctgatagaaaatagggctgaaggggaatttaggaagagaattgat
catagctgtgctgtgcttgcatcagcggcgcaaattgaaattatatccgggagtggttca
atagtaagtcaatttgaagctagacaggctgatagtgcacaagatagcagaagagatcaa
atgcataatggtttaatgagtatgcttagtcgaggtctggaggagacagttgttgcacgt
tgggatgatatagaattaccttcatctcagcatttggagtcaaagaatgacaaacttgtc
agcattggatatgtcggggatgaatgggatgaagaatatgataaagggaagaggaagaag
ataaggggcttcaagcatagctttggtgggcctaatctttttcaagaaattgcagtcgag
aaatcgaagtttaaaagggcaaagtttgaccaatcttgctcagggaaccctccatttagg
atatga

DBGET integrated database retrieval system