KEGG   Glycine max (soybean): 100786606Help
Entry
100786606         CDS       T01710                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 23-like
Organism
gmx  Glycine max (soybean)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
2
AA seq 901 aa AA seqDB search
MAETIVIQTEPPNPPDPSSSTTIATPLLSRNIVFLPVKKPFKGFSNDFHIETLNPSSSEP
RPSGSVAKKHDASEFSEYGLDPELSFGITFRRIGAGLRNLGNTCFLNSVLQCLTYTEPLA
AYLQSGKHKTSCHVAGFCALCAIQNHVSRALQSTGRILSPEDLVGNLRCISRNFRNARQE
DAHEYMVNLLECMHKCCLPSGIPSESPGAYEKSFVHKIFGGRLRSQVKCHQCSYCSNKFD
PFLDLSLEIFKADSLQKALSNFTAAEWLDGGEKEYHCQRCKQKVRALKQLTIHKAPYVLT
IHLKRFHAHDPGQKIKKKIQFGCALDLKPFVSGSYDGDVKYSLYGVLVHAGSSTHSGHYY
CYVRTSNNMWYTLDDNRVSHVSEREVLNQQAYMLFYVRDRKNIVPRKPVDIAKKENMKTN
VNGNRESSTSNHVLQEYPNGTIENKAEKDALVLQKHNVILAESLMQSKRHGSELSSKAQA
QNDSPDGLSVAKSELGCLSSLDHSGKDYSLPHNLKSLAAPVGEKNNLRYENVISKEGIKD
SPSIVPSSTNPQNGELTTDGKCQSPKKNLVKIVDVAAPQDSSTNMTNGICPKTSLIHPKV
NHQLGTSAIGSVCEKASSMTYEDLVGSQGLVLNESVNTSLNTASLNQKPVKKSKKKFLRY
QVSWMHLRPIFHYMVYLGPRKKNHKRSKRRTLGMKNPNKDKMDKLAFSSEDAKPVVFPLL
LSCSESKATKAGYRPGANFKSSDESLIENRAEGEFRKRIDHSCAVLASAAQIEIISGSGS
IVSQFEARQADSAQDSRRDQMHNGLMSMLSRGLEETVVARWDDIELPSSQHLESKNDKLV
SIGYVGDEWDEEYDKGKRKKIRGFKHSFGGPNLFQEIAVEKSKFKRAKFDQSCSGNPPFR
I
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaccatcgtgatccaaacggagcctccgaatccgccagatccttcttcgtcc
actactatcgccactcccttgttgtcgagaaacatcgtgtttcttcccgtcaagaagccc
ttcaagggtttctccaacgatttccacatcgaaaccctaaacccttcctcctccgagcct
cgaccctccggttccgtcgctaagaaacacgacgcttccgaattctccgagtacggcttg
gatccggagctcagcttcggaattaccttccgaagaataggagctggattgcgaaatctg
ggaaacacttgttttctgaactccgtattgcagtgtttgacatatacagaacctctagct
gcgtatctgcaaagtgggaagcataaaacttcatgccacgttgctggattttgtgctctg
tgtgcaatacagaatcatgttagtcgtgcactgcaatcgactgggagaatattatcccca
gaggatttggttgggaatctacgatgcatatcaagaaatttccgaaatgcaaggcaggaa
gatgcacacgagtatatggtgaacttacttgagtgtatgcataaatgttgcctgccttct
ggcataccaagtgaatcacctggtgcttatgagaaaagttttgttcataaaatttttggt
ggtcgtctcaggagtcaggtgaaatgccaccagtgttcttattgctccaacaaatttgat
cctttcttagatttaagtcttgaaatattcaaggcagattcattgcaaaaagcactttca
aattttacggctgcagaatggttggatggaggggagaaggagtaccattgtcaacggtgc
aaacagaaagttagggctctcaaacagctaacaattcataaggcaccttatgtgctaacg
atccacttaaagcggtttcacgcccatgatcctggacaaaagattaaaaagaagattcaa
tttggctgtgcactggacttgaaaccttttgtcagtggctcgtatgatggagatgtaaag
tactctctatatggcgttctggttcatgctggttccagcactcattctggacactattac
tgctatgttcgcacttcaaataacatgtggtataccttggatgacaaccgggtaagtcat
gtcagtgagcgggaagttttaaaccagcaagcatacatgttgttttatgttcgtgataga
aaaaatattgttccaaggaagcctgttgacattgctaagaaggaaaatatgaagactaat
gtgaatggaaatagagaatcttcaacttcaaaccatgtattgcaggaatatccaaatggt
accatcgaaaataaagccgagaaggatgctctagttctgcaaaagcataatgtcatatta
gcagaaagcttgatgcaaagtaaaagacatggatctgaactttcttccaaggcccaggca
cagaatgactcaccagatggactgtctgtagctaaatcagaacttggatgcttgtcatca
ttagatcactctggaaaagattatagtctccctcataatctgaaatctttggctgcacca
gttggagaaaaaaataatttgcgctatgagaatgtaatttcaaaagagggcattaaagat
tctccttcaatagtgccctcatccactaatccccagaatggtgaactcactactgatgga
aaatgtcagtctccgaagaaaaatcttgtcaagatagttgatgttgctgcacctcaagat
tcaagcacaaatatgaccaatggcatttgccctaagacatcactaattcatccgaaagtt
aaccatcagcttggaacttctgcaattggttcggtgtgtgagaaagcaagtagcatgacg
tatgaagatctggttggttctcagggactggttcttaacgagtcagtaaatacatctttg
aatacagcgagtcttaatcaaaagcctgtgaaaaaatcaaaaaagaagttccttaggtat
caggtatcttggatgcatcttcgcccaatcttccattacatggtatacttgggcccacgg
aagaagaatcacaaaagaagtaaacgccgcactttgggtatgaagaatccaaacaaagac
aagatggataagcttgctttctcatcagaagatgccaaacctgttgtatttcctttgtta
ttaagttgctctgaaagtaaagcaaccaaggctggttatagacctggtgctaattttaaa
tctagtgatgaatctctgatagaaaatagggctgaaggggaatttaggaagagaattgat
catagctgtgctgtgcttgcatcagcggcgcaaattgaaattatatccgggagtggttca
atagtaagtcaatttgaagctagacaggctgatagtgcacaagatagcagaagagatcaa
atgcataatggtttaatgagtatgcttagtcgaggtctggaggagacagttgttgcacgt
tgggatgatatagaattaccttcatctcagcatttggagtcaaagaatgacaaacttgtc
agcattggatatgtcggggatgaatgggatgaagaatatgataaagggaagaggaagaag
ataaggggcttcaagcatagctttggtgggcctaatctttttcaagaaattgcagtcgag
aaatcgaagtttaaaagggcaaagtttgaccaatcttgctcagggaaccctccatttagg
atatga

DBGET integrated database retrieval system