KEGG   Glycine max (soybean): 100786678Help
Entry
100786678         CDS       T01710                                 

Definition
ubiquitin carboxyl-terminal hydrolase 10-like
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
gmx  Glycine max (soybean)
Brite
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100786678
Peptidases [BR:gmx01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100786678
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
20
AA seq 928 aa AA seqDB search
MTIADSVFPMDNVASCILLPPEEENRIVSELIKESELNLKEGNLYYVISNRWFSRWQSYV
GPCVGMLSVDKQSSDGHNANMTHPKIADRPGPIDNSDIISKGNSCDNNNLDIHRMLEEGT
DYVLVPEKVWERLLEWYKGGPALPRKLISQGHEHKQYNVEVYPLSLKVTDARDKRQSIVK
LSRKATIGELHELVCKIKGVEQNKACIWDYFNLNKQSLLTVSDPKTLEDANLIMDQDILL
EVSLDRDGSSHSGMDSMGNELALVPLEPSRSSMSIAGGPTMSNGHSTGSSFSLYQGSSVS
SSLTNMDDRYDVYKGERGGLAGLQNLGNTCFMNSSIQCLVHTPPLSEYFLQDYSDEINMD
NPLGMCGELALAFGDLLRKLWSSGRTAIAPRAFKSKLARFAPQFSGYNQHDSQELLAFLL
DGLHEDLNRVKQKPYIEMKDSDGRPDEEVASECWKNHMARNDSLIVDVCQGQYKSTLVCP
VCGKISITFDPFMYLSLPLPSTVTRTMTITVFYCDGSGLPMPYTVTVLKHGSCRDLCQAL
GIACCLKSDEMLLLAEVYEHKIYRYLENPMEPLNSIKDDEHIVAYRVKSGARKTKVEIMH
RWLDNMKAGDRKLFGTPLVTYLVEDPQFGANIEASVHKMLEPLRKAYSSSKSHDGKENGF
ISAGSDEQSNISNTQSESQSLTTGNKEQEGTSCGESSFQLVLTNECCLSCEPIEKASFIK
PNQVVRVFLDWTDKEHELYDASYLRDLPEVHKTGFTVKKTRQEAISLFSCLEAFLTEEPL
GPDDMWYCPRCKEHRQATKKLDLWKLPEILVFHLKRFSYSRYLKNKLDTFVNFPIHNLDL
TKYVKSKDGPSYVYDLYAISNHYGGLGGGHYTAYCKLIDENKWFHFDDSHVSSVTEAEIK
SSAAYVLFYQRNRIKGQMEGETSQVHTV
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcgccgattcagtttttccgatggataatgtggccagttgcatactgcttccg
ccggaggaggaaaaccggatcgtgtcggagttgatcaaggagtcggagcttaatttgaaa
gaaggcaacttatattacgttatttctaacaggtggttttcaaggtggcagagttatgtt
gggccttgtgttggtatgctttcagtcgacaagcaatcttctgatggccataatgccaac
atgactcacccaaagattgcagatagacctgggcctattgataattctgacattatttct
aagggaaatagctgtgacaacaataatttagatattcatcgaatgttggaagagggtaca
gactatgttttagttcctgaaaaagtgtgggaaaggctgttggaatggtacaaaggtgga
cctgctttaccaaggaagttaatttctcagggtcatgaacataagcaatacaatgttgag
gtttacccacttagtctaaaggtgactgatgcgagagataagaggcagtcaattgtaaaa
ttaagcagaaaggcgaccattggtgaacttcatgagctggtgtgcaaaattaaaggagta
gaacaaaacaaggcctgtatttgggattacttcaatttgaacaaacaatcattgctgaca
gtctcagacccgaagacattagaggatgcaaacttgataatggaccaagatattcttcta
gaagtatcacttgatagagatggctcttctcattctggcatggattcaatgggaaatgaa
ttagctttggtgccattagaaccttcaaggtcatctatgtccattgctgggggacctacc
atgtcaaatggtcactcgactgggtctagttttagtttgtatcagggaagttctgtaagt
tcatcgttgaccaatatggatgatagatatgatgtctataaaggtgaaaggggtggtttg
gcagggctgcagaacttggggaatacctgcttcatgaacagttctattcaatgtttagtc
cacactccaccactttctgaatatttcttacaagattacagtgatgaaatcaacatggac
aatcctttaggaatgtgtggtgagttagcacttgcatttggtgacttgttgaggaaattg
tggtcttcagggcgaactgctattgcaccccgtgcattcaagagcaaattggcccgattt
gctccacaattcagtggttataaccagcatgattctcaggaattgcttgcctttttattg
gatggattgcatgaagatttgaatcgtgtgaaacaaaagccttacattgaaatgaaggac
tcggatggtaggccagatgaggaagttgcatctgagtgttggaaaaatcatatggctcgg
aatgattcattgattgttgatgtatgccagggtcaatacaagtcaacattggtttgtcca
gtatgtggcaaaatttcaattactttcgatccattcatgtacttatcattaccactgcct
tccactgtcactcgcacaatgacaataactgtcttttattgtgatgggagtggtcttccc
atgccatacaccgtgacagttctgaagcatggtagctgtagagatctttgccaagcatta
ggcattgcatgctgcttgaagagtgatgaaatgcttttgcttgcagaggtttatgagcat
aaaatttatcgatatctagagaatccgatggaaccattgaattcaataaaggacgatgag
catattgtggcctatcgagtcaaaagtggagccaggaaaacaaaagttgaaataatgcat
cgatggctggataatatgaaggctggagacaggaagctctttgggaccccgttggttact
tatttggtagaagatcctcaatttggagccaacattgaggcatctgtacataaaatgttg
gaacctttaagaaaagcatattcctcaagtaagtctcatgatgggaaggaaaatggtttc
atctcagctggcagtgatgagcaatcaaacatctccaatactcaaagtgaatctcagagt
ttaacaactggcaacaaagaacaagagggaacatcctgtggggagtcatctttccaactt
gttttaactaacgaatgctgtttgagttgtgaacccattgagaaggcttcttttataaaa
cccaaccaagttgtaagagtctttcttgactggactgacaaagaacatgaattatatgat
gctagctacctgagggatctcccggaagttcacaaaactggattcactgtgaaaaaaacc
cggcaagaagctatttctttgttttcttgcttggaggcattcttgactgaagaacctctt
ggaccagatgacatgtggtactgccctagatgcaaggaacacagacaagctacaaagaag
cttgacttgtggaaattgccggagattcttgtttttcacttgaaacggttctcatacagt
agatacctgaaaaacaaacttgacacttttgtgaattttcccattcacaatctggattta
actaaatatgtgaaaagcaaggatggaccgtcttatgtgtatgacctttatgcaatcagc
aaccattatggtggtctaggtggtgggcattacactgcgtattgtaagttgatcgatgaa
aataaatggttccatttcgacgatagtcatgtctcttctgttactgaagctgaaattaaa
tcttcagctgcatatgtgttattttatcagagaaatagaattaaaggccagatggaaggg
gagacatctcaggttcatacagtatag

DBGET integrated database retrieval system