KEGG   Glycine max (soybean): 100786705Help
Entry
100786705         CDS       T01710                                 

Definition
(RefSeq) histone deacetylase 19-like
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
gmx  Glycine max (soybean)
Brite
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100786705
Chromosome [BR:gmx03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     100786705
   HDAC complexes
    Sin3A-HDAC complex
     100786705
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100786705
  Chromatin remodeling factors
   NuRD complex
    100786705
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 497 aa AA seqDB search
MDTGGNSLPSAPDGVKRKVCYFYDPEVGNYYYGQGHPMKPHRIRMTHALLAHYGLLQHMQ
VHKPFPARDRDLCRFHADDYVAFLRSITPETQQDHLRQLKRFNVGEDCPVFDGLYSFCQT
YAGGSVGGAVKLNHDQCDIAVNWAGGLHHAKKCEASGFCYVNDIVLAILELLKQHERVLY
VDIDIHHGDGVEEAFYTTDRVMTVSFHKFGDYFPGTGDVRDIGYGKGKYYSLNVPLDDGI
DDESYHFLFKPIIGKIMEVFRPGAVVLQCGADSLSGDRLGCFNLSIRGHAECVKYMRSFN
VPLLLLGGGGYTIRNVARCWCYETGVALGIEVDDKMPQHEYYEYFGPDYTLHVAPSNMEN
KNSWHLLEEIRSKLLENLSKLQHAPSVQFQERPPDSDLGEADEDHDDGDGPWDPDSDMDI
DVERELVSSKVKKEISEHQPNDLEDQTSGEHLRGSDTAVAETCMKALDISCQKADEDNVK
VEQNTVNDLAKETDLKC
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggataccggtggcaattctttaccatctgcacctgatggggtgaagagaaaggtgtgc
tatttttatgatccggaggttgggaattactattatggtcaaggtcacccaatgaagcca
catcgtatacggatgacacatgctcttctagcccattatggattgctacagcacatgcag
gtccacaagccatttcctgctagagacagggacctttgtcgttttcatgctgatgattat
gttgcattccttcgaagcataactcctgaaacacagcaggatcatctaaggcaactgaaa
cgctttaatgttggtgaagattgtcctgtttttgatggcctctactctttctgtcaaact
tatgcagggggttcagttgggggtgctgtcaagttaaatcatgaccaatgtgatattgct
gtcaactgggctggagggttgcatcatgccaagaagtgtgaggcttctgggttttgctat
gttaatgatatagtccttgcaatcttagaacttctcaaacagcatgagcgtgttctatat
gtggacattgatatccaccatggagatggtgtggaggaagctttctacactactgacaga
gtcatgactgtttctttccataaattcggtgactattttcctggaactggggatgtacgt
gatattggatatggaaaaggaaaatattactctcttaatgttccacttgatgatggcatt
gatgatgagagttatcattttttgttcaaaccaataatcggaaaaataatggaagtgttc
cggcctggtgcagtagttctccagtgcggtgctgattctttatctggagaccgattggga
tgtttcaatctttcaattaggggtcatgcagagtgtgtcaaatacatgagatcattcaat
gtgcccctcttgctactaggtggtggtggctacaccattcggaatgttgctcgttgttgg
tgctatgagacaggagttgctcttggaatagaagttgatgacaaaatgccacagcacgag
tattatgaatattttggtccagattatacccttcatgttgccccaagtaacatggaaaac
aagaattcctggcatttacttgaagaaattcgatctaaactacttgaaaatctttccaag
ctgcagcatgctcctagtgtccaatttcaggaaaggcctcctgattctgatcttggagag
gccgatgaagatcatgatgatggagatgggccatgggatccagattctgacatggacatt
gatgtcgaacgtgagcttgtctcgagcaaagtaaagaaagaaatttctgaacatcagccc
aatgatctggaggaccagacaagtggagagcatttgagaggctctgatactgcagttgct
gaaacttgcatgaaggctctagatatttcttgtcagaaagctgatgaagataatgtgaaa
gtagaacaaaatactgtgaatgatttggccaaagagacggacctgaagtgttaa

DBGET integrated database retrieval system