KEGG   Glycine max (soybean): 100786715Help
Entry
100786715         CDS       T01710                                 

Definition
clathrin heavy chain 2-like
Orthology
K04646  
clathrin heavy chain
Organism
gmx  Glycine max (soybean)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100786715
Exosome [BR:gmx04147]
 Exosomal proteins
  Proteins found in most exosomes
   100786715
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 1700 aa AA seqDB search
MAAANAPITMKEALTLPSIGINSQFITFTHVTMESDKYICVRETAPQNSVVIIDMNMPNQ
PLRRPITADSALMNPNSRILALKAQLQGTTQDHLQIFNIEMKAKMKSYQMPEQVVFWKWI
SPKMLGLVTQTSVYHWSIEGDSEPVKMFERTANLANNQIINYRCDPTEKWLVLIGIAPGA
PERAQLVKGNMQLFSVDQQRSQALEAHAASFAQFKVPGNENPSVLISFASKTLNAGQVIS
KLHVIELGAQPGRPSFTKKQADLFFPPDFADDFPVAMQISHKYNLIYVITKLGLLFVYDL
ETATAVYRNRISPDPIFLTSEATSVGGFYAINRRGQVLLATVNEQTIVNFVSGQLNNLEL
AVSLAKRGNLPGAEKLVVERFHELFAQTKYKEAAELAAESPQGILRTPDTVAKFQSVPVQ
AGQTPPLLQYFGTLLTRGKLNAFESLELSRLVVNQNKKNLLENWLAEDKLECSEELGDLV
KTVDNDLALKIYIKARATPKVVAAFAERREFDKILIYSKQVGYTPDYLFLLQTILRTDPQ
GAVNFALMMSQMEGGSPVDYNTITDLFLQRNLIREATAFLLDVLKPNLPEHGFLQTKVLE
INLVTFPNVADAILANGMFSHYDRPRIAQLCEKAGLYVRALQHYTELPDIKRVIVNTHAI
EPQSLVEFFGTLSKEWALECMKDLLLANLRGNLQIIVQVAKEYCEQLGVDACIKLFEQFR
SYEGLYFFLGSYLSSSEDPDIHFKYIEAAAKTGQIKEVERVTRESNFYDAEKTKNFLMEA
KLPDARPLINVCDRFGFVPDLTHYLYTNNMVRYIEGYVQKVNPGNAPLVVGQLLDDECAE
DFIKGLILSVRSLLPVEPLVEECEKRNRLRMLTQFLEHLVSEGSQDVHVHNALGKIIIDS
NNNPEHFLTTNPYYDSRVVGKYCEKRDPTLAVVAYRRGQCDDELINVTNKNSLFKLQARY
VVERMDGDLWAKVLDPDNEYRRQLIDQVVSTALPESSSPEQVSAAVKAFMTADLPHELIE
LLEKIVLQNSAFSGNFNLQNLLILTAIKADPSRVMDYVNRLDNFDGPAVGEMAVEAQLYE
EAFAIFKKFNLNVQAVNVLLDKIHSIDRAVEFAFRVEEDAVWSQVAKAQLRDGLVSDAIE
SFIRADDATQFLDVIRAAEDGNVYHDLVKYLLMVRGKAKEPKVDSELIYAYAKIDRLSDI
EEFILMPNVANLQNVGDRLYDEALYEAAKIIFAFISNWAKLAITLVKLQQFQGAVDAARK
ANSSKTWKEVCFACVDAEEFRLAQICGLNIIIQVDDLEEVSEYYQNRGCFNELISLMESG
LGLERAHMGIFTELGVLYARYRPEKLMEHIKLFSTRLNIPKLIRACDEQQHWKELTYLYI
QYGEFDNAATTIMNHSPEAWDHMQFKDVVVKVANVELYYKAVHFYLEEHPDLINDVLNVL
ALRVDHARVVDIMRKAGHLRLVKPYMIAVQSNNVSAVNEALNEIYVEEEDYDRLRESIDL
HDNFDQIGLAQKIEKHELLEMRRVAAYIYKKAGRWKQSIALSKKDNLYKDAMETASQSGE
RELAEELLVYFIDQGKKECFASCLFVCYDLIRADIVLELAWMHNMIDFAFPYLLQFIREY
TGKVDELVKDKIEAQNEVKAKEQEEKDVVAQQNMYAQLLPLALPAPPMPGMGGFAPPPPM
GGLGMPPMPPYGMPPMGSSF
NT seq 5103 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgcgaatgctccgatcaccatgaaagaagccctaactttgccgagcattggc
atcaattcgcaattcatcacgtttacgcacgtgacgatggaatcggataagtatatatgt
gttcgtgaaaccgctccacagaatagcgtggttatcattgatatgaacatgccaaatcaa
cctttgaggaggcctatcaccgcggattccgctcttatgaatccgaattctagaattctt
gctttgaaagcccaactgcaaggaactactcaagatcacctgcaaatatttaacattgag
atgaaagcaaagatgaaatcatatcagatgcctgagcaggtagtcttttggaagtggatt
agccccaagatgttgggtctcgtaacacagacctctgtataccactggtcaattgaaggt
gactctgaacctgttaagatgtttgagagaacagcaaatttggcaaacaaccagataatt
aattatcgatgtgaccctacagaaaaatggttggttttgattggcattgctcctggtgca
cctgagagggcacaattggtaaagggaaacatgcaacttttctcagtggatcaacaacgt
agtcaggctcttgaagctcatgctgcatcatttgcccaatttaaagttcctgggaatgaa
aatccttctgttttgatttcttttgcctcgaagacacttaatgctggtcaagttatatcc
aagttgcatgttattgaactgggagcacaaccagggaggccatcattcacaaagaagcaa
gctgatcttttcttccccccagattttgctgatgattttccagttgccatgcagatatcc
cacaaatacaatttgatttatgtgattacgaaacttggcctactatttgtctatgatttg
gagacagctactgctgtatataggaacagaatcagtccagatcctatatttttgacctca
gaagctacatctgtgggaggcttttatgccatcaacaggagaggccaggttttattggct
actgttaatgaacaaaccattgtgaattttgtcagtggccaactaaacaatttggagcta
gcagttagtcttgccaaaagaggaaatcttcctggtgctgaaaagctggtagtggaacgt
tttcatgaactgtttgcccaaacaaaatataaggaagctgcagaacttgcagctgaatct
ccacaaggaatccttcgaactcctgacacagttgccaaatttcagagtgttcctgtgcaa
gctgggcaaactcctcctctgttgcagtattttggaacacttttaacaaggggaaagctg
aatgcctttgaatcattagaattatcacggttggttgtgaaccagaacaagaaaaatctg
ttggaaaattggttggcagaggacaagcttgaatgcagtgaggagctaggagatctcgtt
aagactgtggacaatgatcttgctttaaaaatatatatcaaagccagagctactccaaaa
gttgttgctgcgtttgctgagaggagggagtttgacaaaattctgatttactctaaacag
gttgggtacacacctgactacctcttccttctgcaaacaattctccggacagatcctcag
ggcgctgttaattttgcattaatgatgtctcaaatggagggaggtagcccagttgattac
aacacaataactgatctctttcttcagagaaatctgattcgagaggcaacagcttttctc
ctggatgttttaaagccgaatctaccagaacatgggttccttcagacaaaggtgttggag
ataaatctggtgactttccccaatgttgctgatgcaatattggctaatggcatgttcagc
cattatgaccgtcctcgtattgcccaactttgtgaaaaagctggcctttatgtgcgagct
ttgcaacattacacagaattaccagacatcaaacgcgtgattgttaatacacatgcaatt
gaacctcagtcactcgtagagttttttggtacactgtcaaaagaatgggcattagaatgc
atgaaagacttactgctggccaatcttaggggcaacctacagatcattgtgcaggttgct
aaagaatattgtgagcaattgggcgttgatgcctgcataaaactttttgagcaatttagg
tcatatgagggactgtactttttccttggatcatacttgagctccagtgaggatcctgac
attcactttaagtacattgaggcagcagcaaagactggtcaaatcaaggaggttgagcgt
gtgacaagagaatcaaatttctatgatgctgagaaaaccaaaaactttctgatggaggct
aaacttccagatgcacggcctttgattaatgtttgtgatcgttttggatttgttccagat
ctaacacactatctatacacaaacaacatggttcgctacattgaaggctatgttcagaag
gtgaacccagggaatgcacctttagttgttgggcagctgctagatgatgaatgcgcagaa
gattttatcaaaggcttgatcctttctgttcgttcattactgccagtggagccccttgtg
gaggaatgtgagaagaggaatcgacttcgtatgctcacacagttcttggaacaccttgta
agtgagggaagccaggatgtacatgttcacaatgcactgggtaaaattatcattgatagc
aacaacaacccagaacatttcctcacaaccaacccatactatgattctcgagttgtgggc
aagtattgtgagaaacgggatcccaccttagcagttgtagcttatcggcgaggacaatgt
gacgatgaacttatcaatgtcaccaacaaaaattctttgttcaaactgcaagcaagatat
gttgttgagagaatggatggtgatttgtgggctaaagttcttgatcctgataatgaatat
agaaggcaacttattgatcaggttgtatctactgctttgcctgaaagctcaagccctgag
caagtttctgcagctgttaaggctttcatgacagccgatctgccccatgaattgattgaa
cttcttgagaagattgtgcttcagaattctgcattcagtggaaactttaatttgcagaat
cttcttattttgacagcaataaaggctgatccatccagagttatggattatgttaataga
ttggataattttgatgggcccgcagttggagaaatggctgtagaagctcagttatatgag
gaagcatttgccatttttaagaagttcaacttgaatgttcaagcagtcaacgtgttgctt
gataagattcatagcattgatagagctgttgagtttgctttccgagttgaagaagatgct
gtttggagtcaggtggccaaggctcaactcagggatgggctagtaagtgatgcaattgag
tcatttatacgagctgatgatgctacacaatttttagatgttatccgtgctgctgaagat
ggcaatgtttaccatgacttggtgaaatacttgctaatggtaagagggaaagcaaaagaa
cccaaggtcgacagtgagctcatttatgcatatgcaaaaatagataggctgagtgacatt
gaggagttcattcttatgcctaatgttgctaatcttcaaaatgttggtgaccggttgtac
gatgaagcattatatgaagctgcaaaaatcatatttgcttttatatctaactgggccaag
ttggctatcacactggtcaaattacaacagtttcaaggtgctgttgatgcagcaaggaaa
gccaacagctcaaagacatggaaggaagtttgctttgcttgtgttgatgcagaggagttt
cgtttggcccaaatttgtggactaaacattattattcaggtggatgacttggaagaagtc
agtgaatattaccaaaacagaggttgcttcaatgagctcatatctctcatggagagtggt
ttagggttagaacgggcacatatgggcatctttactgagttaggagttctgtatgctaga
taccgccctgagaagcttatggagcatatcaaactattctcaacccgcctcaatattcct
aaactcataagagcttgtgatgaacaacagcattggaaagaattgacctatttgtatata
caatatggtgagtttgataatgctgcaactaccatcatgaaccattcacctgaagcatgg
gatcacatgcaattcaaagatgttgttgttaaagttgccaatgtggagttgtactacaag
gctgttcacttctacttggaagagcatccagatcttatcaatgatgttctgaacgtcctt
gcacttcgtgtggaccatgcacgtgttgttgacatcatgcggaaggctggtcacctccgt
cttgtgaaaccgtatatgattgcagttcaaagcaacaatgtatctgctgttaatgaagcg
ttgaatgagatatatgtcgaggaggaagattatgatagattgcgcgagtcaattgatttg
cacgataactttgatcaaataggccttgctcaaaagattgaaaagcatgagcttcttgag
atgagacgtgttgctgcttatatttacaagaaggcaggtaggtggaagcagtctattgct
ttgtcaaagaaggataacctttacaaagatgccatggagacagcctcccaatccggggag
cgtgaacttgctgaggagttgcttgtttatttcattgatcagggaaagaaggaatgcttt
gcctcatgtctatttgtttgctatgatctcatacgggcagacattgttcttgaactagct
tggatgcacaatatgattgactttgccttcccatatctattgcagtttattcgtgagtac
actggcaaagtcgatgaactagtgaaggacaaaattgaagcacaaaatgaagtgaaggct
aaagagcaagaagaaaaggatgtagttgcacaacagaacatgtatgctcaattgttgcct
cttgctttgcctgcaccaccaatgcctggaatgggaggctttgctcctccccctccaatg
ggtggactggggatgcccccaatgcctccttatggtatgccacccatgggcagcagtttt
tga

DBGET integrated database retrieval system