KEGG   Glycine max (soybean): 100786873Help
Entry
100786873         CDS       T01710                                 

Definition
histone H2B.2-like
Orthology
K11252  
histone H2B
Organism
gmx  Glycine max (soybean)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 225 aa AA seqDB search
MAPKRAEKLVVRSTKKVVESSVLVSVVGKRLTRGKKDTQTTDGEEEVGSQEHLVVIPIQE
VTPQAQKDSPNSAITTENKAEQENNTQDGGVENNQEEEEEHEEVKEKKNKAKTPKGKNGK
EKKRGRKKGRRSVEGYQRYVYRVLKQVHPEMGISSKCMTVLNNLMNDMFERLAFEASKLK
DYTGHMTLSSREIQGAVRLVLPGELGKHAIAEGVKAVNNYTSYDA
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggctccaaaacgtgctgagaagctagtggtcagatccaccaagaaagttgtggaatca
agtgtgctggtttctgttgtaggcaaaagactaacccgtggaaaaaaagatactcaaaca
actgatggagaagaagaagtaggtagccaagagcatctggtggtcattcctattcaagaa
gtgactcctcaagcacaaaaggattcacctaactctgccatcaccacagaaaacaaagct
gagcaagagaacaatactcaagatggtggagtcgaaaataatcaagaggaagaggaagag
catgaggaagtgaaagagaagaagaataaggccaagaccccaaaagggaaaaatgggaag
gagaaaaaaagagggagaaaaaagggtaggagaagtgttgaagggtaccagaggtatgtg
tatagggtgttgaagcaagtgcaccctgaaatgggaatttcttccaagtgcatgactgtt
ctgaacaacttgatgaatgacatgtttgagaggctggcttttgaggcttctaagctgaag
gactacactggacacatgacattgtcttcaagggagattcaaggagcagtgaggctggtt
ttgccaggagaacttggaaagcatgcaattgctgaaggggtcaaagctgttaacaactac
acatcctatgatgcttga

DBGET integrated database retrieval system