KEGG   Glycine max (soybean): 100786953Help
Entry
100786953         CDS       T01710                                 

Definition
beta-hexosaminidase 2-like
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
gmx  Glycine max (soybean)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:gmx00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:gmx00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:gmx00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:gmx00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:gmx00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 586 aa AA seqDB search
MPRTNTITMTKLEPTLFLLLLFMLSCLITVNNAHSTTIINVWPKPRNLTWAPPYQATLIA
STFTIITTTTPHHNKHLSAAIIRYQNLVKSEHHHPLVPPGVNISTNLPPLNSLTLTVLDP
GAGLVHDVDESYTLSIPPSSSSATLTAKTTWGAMRGLETFSQLAWGNPTCVAVGVHLWDS
PLYAHRGIMLDTSRNYFPVKDLLRTVEAMSMNKLNVFHWHVTDSQSFPLVLPSEPALAEK
GAYASHMVYSPEDVKRVVEFGLDHGVRVMPEIDSPGHTGSWALAYPEIVACANMFWWPAE
GDILAAEPGTGHLNPLNPKTYQVLKNVIRDMTTLFPEPFYHSGADEIVPGCWKTDPTIQK
YLSNGGTLSQVLEKFINNTLPFIVSLNRTVVYWEDVLLSETVHVPSTILPKEHVVLQTWN
NGHNNTKRIVSSGYRTIVSSSDFYYLDCGHGDFVGNNSIYDQQNGDNKDNGGSWCGPFKT
WQTIYNYDIAYGLSEEEAKLVLGGEVALWTEQADSTVLDGRIWPRTSALAESLWSGNRDE
KGMKRYAEATDRLNEWRSRMVSRGIGAEPIQPLWCVRNPGMCNTVQ
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgtaccaacaccattactatgacaaaactagaaccaacactctttttactacta
cttttcatgttgtcatgcctaataacagtgaacaatgcacactcaacaacaatcatcaac
gtgtggccaaaaccaagaaacctcacgtgggccccaccataccaagccaccctcattgcc
tccacattcaccatcatcaccaccacaactccccaccacaacaaacacctctccgccgcc
atcatccgctaccaaaacctcgtaaaatccgagcaccaccacccacttgtccccccaggg
gtgaacatctccacaaacctcccaccactgaattccctcaccctcactgtccttgatccc
ggtgcaggactcgtccacgacgtggacgagtcctacaccctctccatccccccttcttcc
tcctcagccaccctcactgcaaagaccacgtggggagccatgcgaggcctggagacgttc
tcccagctcgcatggggcaaccccacgtgcgttgcagtgggggtccacttgtgggattcc
ccgctctacgcccaccgtggcatcatgcttgacacttcaaggaactattttccagtgaag
gacttgttgaggacagtggaagccatgagcatgaacaagctcaacgtgttccactggcac
gtcacggactcgcagtctttcccattggtccttccttcggagcctgctttggctgaaaag
ggtgcttatgcctctcacatggtgtactcaccagaggatgtgaaaagggttgtggagttt
ggtcttgatcatggggttcgtgttatgcctgagattgactcacctgggcacactggatct
tgggctttagcctaccctgaaattgtagcttgtgccaacatgttctggtggccagcagaa
ggtgacattcttgctgcagaaccaggaacaggtcatttgaaccctctaaaccccaagact
taccaagtcctaaagaacgtaattcgtgacatgacaacgttgtttccagaaccattttac
cactcaggtgctgatgagattgtaccaggttgctggaaaactgatcccacaattcagaag
tatctgtcaaatggtggaactctcagccaagttcttgagaagttcatcaacaacactctc
cctttcatagtgtccctcaaccgaaccgtcgtctattgggaagatgttttgctaagtgaa
acagtccatgtgccatccacaattcttcccaaggagcatgtggttttgcagacatggaac
aatggacacaacaacaccaaaaggattgtttcctcggggtatcgcaccattgtgtcgtca
tcagacttctactatctggattgtggccatggtgactttgtagggaataatagtatctat
gatcagcaaaatggggataacaaagacaacggtggctcttggtgtggacctttcaagaca
tggcaaaccatatacaattatgacatagcatatgggttgagtgaggaagaagcaaagttg
gttttgggtggggaagtggcactttggacagaacaagctgattctactgttttggatgga
agaatttggccaagaacttctgcgttggctgagtcattatggtcaggaaatagggatgaa
aagggtatgaagagatatgcagaggccacagatagattgaatgaatggagaagcagaatg
gtaagtagaggaataggtgctgagcctattcagccactttggtgtgttagaaaccctggc
atgtgcaacacagttcaataa

DBGET integrated database retrieval system