KEGG   Glycine max (soybean): 100787307Help
Entry
100787307         CDS       T01710                                 

Definition
alcohol dehydrogenase-like 3-like
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
gmx  Glycine max (soybean)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:gmx01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:gmx00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:gmx00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:gmx00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 398 aa AA seqDB search
MEDPEVIIGSLNPNDTRGKTVTCKAAVAYGPGEPFVVERVLVHPPQKMEVRIKILFTSIC
HTDLSAWQGENEAQRAYPRIFGHEASGIVESVGEGVNDMKEGDLVVPIFNGECGDCKYCK
CEKTNMCERFGVDPMKKVMASDGATRFSTMDGKPIFHFLNTSTFTEYTVVDSACVVKIHV
DGDGDLNPYIKRLTLLSCGVSTGVGAAWNTADVHFGSAVAVFGLGAVGLSVAEGARARGA
SKIIGVDINSDKFIKARAMGITDFINPRDDEKPVYERIREMTCGGVHYSFECTGNLNVLR
DAFLSAHEGWGLTVILGIHPSPQLLPIHPMELFQGRRIVGSVFGGFKGKTQLPHFAKECM
DGVVKLDDFITHELPIEEINKAFDLLTVGKSLRCLLHF
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggaagatccagaggttattattgggagcttgaatccaaatgataccaggggaaagacc
gttacttgcaaagctgccgtggcatatggtcctggagagccctttgtggtggaacgtgtt
cttgttcatcctcctcagaaaatggaggttcgaatcaagatcctcttcacttcaatctgc
cacaccgatctcagtgcttggcaaggcgagaatgaggctcaacgtgcatatcctcggatt
ttcggccatgaagcttccgggattgtggagagtgtgggtgaaggagtaaatgacatgaaa
gaaggggacttggtggtgccaattttcaatggggaatgtggggattgtaaatattgcaag
tgtgagaaaaccaacatgtgtgagagatttggggtggatcctatgaagaaggtgatggct
agtgatggtgccactaggttttctacaatggatggaaaacccatcttccatttcttgaac
acttcaactttcacggagtacacggtggtggattcagcatgcgtcgtcaagattcacgtt
gatggcgatggcgacctcaatccctacattaaaagacttaccttactcagttgtggtgta
tctacgggtgttggagctgcttggaataccgctgatgtgcattttggttcagctgtagct
gtctttggtttaggtgctgtgggtctctctgtagcagaaggggcacgagccagaggtgca
tccaaaataataggcgtggacatcaattctgacaaatttatcaaagcccgagcaatgggc
atcactgacttcataaatccaagggatgatgagaagccagtatatgagaggatcagggaa
atgacttgtggaggtgtgcactatagttttgaatgtactggaaatttaaacgttctaagg
gatgccttcttgtcagctcatgagggttggggattgactgtgatattagggattcatcca
tcaccacaattgcttcccatccacccaatggagttgttccaaggtcgcagaatagtagga
tcagtttttggaggcttcaaagggaagactcaattgccacattttgccaaagaatgcatg
gatggagtggtgaagttggatgattttatcactcacgagcttccaatcgaggagataaac
aaggcctttgatcttttaaccgtcggaaagtcactgagatgtcttctacacttctaa

DBGET integrated database retrieval system