KEGG   Glycine max (soybean): 100787410Help
Entry
100787410         CDS       T01710                                 

Gene name
GMATG3A
Definition
autophagy-related protein 3-like
Orthology
K08343  
ubiquitin-like-conjugating enzyme ATG3 [EC:6.3.2.19]
Organism
gmx  Glycine max (soybean)
Pathway
Regulation of autophagy
Class
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:gmx04140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 313 aa AA seqDB search
MVLTQKLHEAFKGTVERITGPRTVSAFKEKGVLSVSEFVTAGDNLVAKCPTWSWESGDPG
KRKPYLPPEKQFLITRNVPCLRRAASVEEEYEAAGGEVLLDDEDNDGWLATHGKPKETKS
DEDENLPSMESLEISKKGSIKQIHSYMGAEEGEDIPDMAEFDDTSNVENDPATLQSTYLV
AHEPDDDNILRTRTYDISITYDKYYQTPRVWLTGYDESRMLLQPELVLEDVSQDHARKTV
TIEDHPHLPGKHASIHPCRHGAVMKKIIDVLMSRGVEPEVDKYLFLFLKFMASVIPTIEY
DYTMDFDLGSSSN
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggttctgactcagaagcttcacgaagccttcaaaggcaccgtcgagaggattactggc
ccccgaaccgtttccgccttcaaagaaaaaggagttctcagtgtctctgagttcgtcacc
gctggcgataatctcgttgccaaatgccccacctggtcctgggaatcgggtgatccaggc
aagaggaagccatacttgccacctgagaaacagttcttgattactagaaatgtgccttgt
cttcggagagctgcatctgttgaagaggaatatgaagctgctggaggggaagttctactc
gatgatgaagataatgatggctggctagcaactcatgggaaacccaaagaaaccaaatct
gatgaggatgagaatttaccttccatggaaagcctagaaatcagcaaaaagggttctatt
aagcaaattcattcctacatgggagctgaagagggagaagatattccagatatggcagag
tttgacgatacttccaatgttgaaaatgatcctgccactcttcagtccacatatctagtt
gctcatgaacctgatgacgataatattcttcgaactcggacttacgatatcagcatcacg
tatgataaatattatcaaacaccacgagtatggcttactgggtatgacgagtcaaggatg
cttttgcaaccagaacttgttcttgaagatgttagtcaagaccatgcacgcaaaacggta
acaattgaggaccatcctcacttgccagggaagcatgcatctattcatccatgtcgacat
ggagcagtgatgaagaaaatcattgatgtgttgatgtcacgcggagttgagcctgaagtt
gacaagtacctatttttattcctaaaatttatggcttctgtaattccaacaattgagtat
gattacacgatggactttgatcttggtagctccagcaattga

DBGET integrated database retrieval system