KEGG   Glycine max (soybean): 100787410Help
Entry
100787410         CDS       T01710                                 

Gene name
GMATG3A
Definition
(RefSeq) autophagy-related protein 3-like
  KO
K08343  
ubiquitin-like-conjugating enzyme ATG3
Organism
gmx  Glycine max (soybean)
Pathway
Autophagy
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Cellular Processes
  Transport and catabolism
   04140 Autophagy
    100787410 (GMATG3A)
Ubiquitin system [BR:gmx04121]
 Ubiquitin-conjugating enzymes (E2)
  UBL-conjugating enzymes
   100787410 (GMATG3A)
Mitochondrial biogenesis [BR:gmx03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    100787410 (GMATG3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 313 aa AA seqDB search
MVLTQKLHEAFKGTVERITGPRTVSAFKEKGVLSVSEFVTAGDNLVAKCPTWSWESGDPG
KRKPYLPPEKQFLITRNVPCLRRAASVEEEYEAAGGEVLLDDEDNDGWLATHGKPKETKS
DEDENLPSMESLEISKKGSIKQIHSYMGAEEGEDIPDMAEFDDTSNVENDPATLQSTYLV
AHEPDDDNILRTRTYDISITYDKYYQTPRVWLTGYDESRMLLQPELVLEDVSQDHARKTV
TIEDHPHLPGKHASIHPCRHGAVMKKIIDVLMSRGVEPEVDKYLFLFLKFMASVIPTIEY
DYTMDFDLGSSSN
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggttctgactcagaagcttcacgaagccttcaaaggcaccgtcgagaggattactggc
ccccgaaccgtttccgccttcaaagaaaaaggagttctcagtgtctctgagttcgtcacc
gctggcgataatctcgttgccaaatgccccacctggtcctgggaatcgggtgatccaggc
aagaggaagccatacttgccacctgagaaacagttcttgattactagaaatgtgccttgt
cttcggagagctgcatctgttgaagaggaatatgaagctgctggaggggaagttctactc
gatgatgaagataatgatggctggctagcaactcatgggaaacccaaagaaaccaaatct
gatgaggatgagaatttaccttccatggaaagcctagaaatcagcaaaaagggttctatt
aagcaaattcattcctacatgggagctgaagagggagaagatattccagatatggcagag
tttgacgatacttccaatgttgaaaatgatcctgccactcttcagtccacatatctagtt
gctcatgaacctgatgacgataatattcttcgaactcggacttacgatatcagcatcacg
tatgataaatattatcaaacaccacgagtatggcttactgggtatgacgagtcaaggatg
cttttgcaaccagaacttgttcttgaagatgttagtcaagaccatgcacgcaaaacggta
acaattgaggaccatcctcacttgccagggaagcatgcatctattcatccatgtcgacat
ggagcagtgatgaagaaaatcattgatgtgttgatgtcacgcggagttgagcctgaagtt
gacaagtacctatttttattcctaaaatttatggcttctgtaattccaacaattgagtat
gattacacgatggactttgatcttggtagctccagcaattga

DBGET integrated database retrieval system