KEGG   Glycine max (soybean): 100787958Help
Entry
100787958         CDS       T01710                                 

Definition
(RefSeq) ribokinase-like
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    100787958
Enzymes [BR:gmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     100787958
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase
Motif
Other DBs
NCBI-GeneID: 100787958
NCBI-ProteinID: XP_003541808
Position
13
AA seq 361 aa AA seqDB search
MSIGTTLLSTPPHYCFHSNTQTTFLSTVTPIQNLSIRNNNFRVLCFSSDPSQLPPVVVVG
SANADIYVEVDRLPGEGETLAARSGQTIAGGKGANQATCSAKLAYPTYFVGQVGDDAYGR
LVTAGLRGGGVRLDNLAVVASAATGHAVVMLQSNGQNSIVYIGGANLSCWPSSLPRQHLD
LVAQAGIVLLQREIPDAVNAQVAQAAKNAGVPVVLDAGGMDGPLPPQLINFVDILSPNET
ELARLTGMPTESFEEIQQAALKCHEMGAKQVLVKLGHKGSALFVEGEKTIQQPAILAKTV
VDTTGAGDTFTAAFAVALVEGKSKKECLRFAAAAACLCVQVKGASPSMPDRKSVLDLLNC
Q
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcggaacaacactactttcaacaccaccacattactgtttccactccaacact
caaaccacattcctcagcaccgttactccaattcaaaacctctctatccgcaataacaat
ttcagagtcctctgtttctcttcggacccgtcgcagttgccgccggtggtggtggtgggg
tccgccaacgccgacatctacgtcgaggtagaccggctcccgggcgagggcgagaccctg
gcggcgaggtccgggcagacgattgccggcggcaagggcgccaaccaggccacgtgctcc
gccaagctcgcgtacccgacctacttcgtcgggcaggtcggggacgacgcttacgggaga
ctcgtcacggcgggcctccgcggtggcggggttcgcctcgataatctcgccgtggtggct
tcggcggcaacgggtcatgcagttgtgatgctccagtccaacggccagaactccatcgtc
tacattgggggtgccaacttgagctgctggcctagttccctgccacgtcagcatttggac
ctcgttgcccaagctggcatcgttttgctgcagagggagattcctgatgctgtcaatgct
caagtcgcacaggctgccaaaaatgctggggtgccagtagtgttggatgctggaggcatg
gatgggccacttccgccacaattaataaattttgttgatattttgagtcctaatgaaact
gaacttgcacgccttacgggaatgccaacagaaagttttgaagagattcaacaggctgct
ttgaaatgccatgaaatgggagctaagcaagttcttgtgaaacttggacacaaaggatct
gccctttttgtagaaggagaaaaaacaattcagcagcctgccatacttgctaaaacagtt
gttgatacaactggtgctggtgatacttttactgctgcttttgccgtggccttggttgag
ggcaagtccaaaaaggaatgcctcagatttgccgctgctgcagcttgtctctgtgttcaa
gtgaagggagcctctcccagcatgcctgataggaaatctgttttggatcttcttaattgt
caatga

DBGET integrated database retrieval system