KEGG   Glycine max (soybean): 100788172Help
Entry
100788172         CDS       T01710                                 

Definition
(RefSeq) indole-3-glycerol phosphate synthase, chloroplastic-like
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gmx01100  Metabolic pathways
gmx01110  Biosynthesis of secondary metabolites
gmx01230  Biosynthesis of amino acids
Module
gmx_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    100788172
Enzymes [BR:gmx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     100788172
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IGPS ThiG
Motif
Other DBs
NCBI-GeneID: 100788172
NCBI-ProteinID: XP_003545642
UniProt: I1M7M5
Position
14
AA seq 392 aa AA seqDB search
MEGLASLKAPFPATPFLSSRPRTSILPSQASFRKRSSFLSFSVHAQVESDDGSAVVATSG
ESVTEVLKIKEWEVGMFQNEVAASQGIRIRRRPPSGPPLHYVGPFQFRLQNEGNTPRNIL
EEIVWNKDTEVSQLKERKPLGVLKKALENAPPARDFIGALKAANERTGLPGLIAEVKKAS
PSRGILREDFDPVEIAKAYEKGGAACLSVLTDEKYFKGSFENLEAIRKAGIKCPLLCKEF
IIDAWQLYYARTKGADAVLLIAAVLPDLDIKYMIKICKLLGLTALVEVHDEREFDRVLAI
EGIELIGINNRNLETFELDISITKKLLEGERGKIIHERGIIMVGESGLFTPDDIAYVQEA
GVKAILVGESIVKQSDPGKGISNLFGKDISLG
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggaaggtttggcttccctcaaggctccctttccggccaccccatttctctcttccaga
cccagaacctctattcttccatcccaagccagttttcgtaaaagaagctcctttttatcc
ttttctgttcatgcccaggtggagtctgatgatggttcagctgtagtagccacatctggt
gaatctgtgacagaggttctgaaaattaaggagtgggaggtgggaatgttccaaaatgag
gttgcagctagccagggtataagaataaggagaaggcctccatctggaccccctttgcat
tatgtaggaccatttcaattcaggttgcagaatgagggcaatacgccccggaacattttg
gaagagattgtgtggaataaggacacagaagtctcacagcttaaagaaagaaaacccctt
ggcgtgctgaagaaagctcttgaaaatgcacctcctgctagggattttattggtgctcta
aaggcagccaacgaacgaactggacttccagggttgattgctgaagtgaagaaggcatca
ccaagtagaggtatcttgagagaagactttgacccagttgaaattgctaaggcttatgag
aaaggtggagcagcatgtctaagtgttttgacagatgaaaagtattttaagggaagcttt
gaaaatcttgaggcaataagaaaggctggcataaagtgccctttgttgtgcaaagaattc
atcatagatgcatggcaactctactatgctcgaactaaaggtgcagatgcagtcctttta
attgctgctgttttgcctgatcttgacatcaaatacatgattaagatatgcaaattactc
ggattgactgcgcttgttgaggttcatgatgagagggaatttgatcgtgttcttgcaata
gaggggattgagcttattggcattaacaaccgcaatcttgaaacatttgagttggatatc
agcatcacaaagaaacttcttgaaggagagcgaggcaaaataatccacgagagaggcata
attatggttggggaatctggtctctttaccccggacgatattgcctatgttcaggaagct
ggtgttaaagctatattggttggagagtctattgtaaaacaaagtgatcctggaaaggga
atcagcaatctctttggcaaagatatctctttgggttga

DBGET integrated database retrieval system