KEGG   Glycine max (soybean): 100788459Help
Entry
100788459         CDS       T01710                                 

Definition
histone-lysine N-methyltransferase EZ1-like
Orthology
K11430  
histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
gmx  Glycine max (soybean)
Brite
Enzymes [BR:gmx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100788459
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 786 aa AA seqDB search
MGEKTIDSTSKHREQHGEAKDVVRRTLKTKIKQLTNQILVERGQSVKEKIQRHWEHLELL
FSIVMSIIFERGSLETEKNVNMLSSRIHNPLCKLSGFPKGIVEKNQINNVDLSPTKSIRI
PHTDKLPQYTSWVYVARNERMVDDQSVIGKYQMYHDKNKGEMVICSDNEEEIVDPEDVKH
EFTEVEDKFLRMTLEEYGCTEEVLNVVKKFVKTTNSEIQERYEKLKEKNMEILDQHCEDC
HCRGCENHLGLCLEKSLSVTLETFNNLLCRQCLIFDCPMHGINKPLVYHSENQPVWLEPE
GDKKPCSDQCYLMLKDARILSKNSTQWSFQDKVITTMEEDSILPRDDEENHTVYXASLKS
LVEHTSEKLTISGSSGHGECDKRVVDGQKDLINGIKLNQISISREVQANGMSSDSYWRPL
EMDLYLKGVKMFGKNSCLIAITLLPGLKTCLEVARYMFGGGELMTNGFIPSSIMEKNEKI
NAGCTDQEMSSRSRPQRKKGKPKKFNYSRKSAGLPPRWRKIAYGQNLCNKQYTPCGCHGI
CGKECSCLVNGTCCEKYCGCSKHCSNRFRGCRCTKSQCKSRSCPCFAANRECDPDVCQNC
WVSCGDDSLGRLPRHEDAKCGNMNLLLGQKERILLAKSDVIGWGAFAKNPISKNVCLGEY
TGELIPPKEAEKRGKLYDRINTSFLFNLNDQWVIDAFRMGDKLKFANHSSKPNCYAKVML
VGGDHRVGIFARENIKAGDEIFYDYGYDLDSAPLWALPPNEAAKKDKLVVSLSRTKKKEK
KSVSFQ
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgggggaaaaaactattgactctacttctaaacatcgggaacaacatggagaggcaaaa
gatgttgttagaagaaccttgaagaccaagattaaacaattaactaatcaaatccttgtt
gagagagggcaatcagtcaaagaaaaaattcaaagacattgggagcatcttgagcttttg
ttttcaatagtcatgtcaataatatttgaaagggggtctttggaaaccgagaaaaatgtc
aatatgctttcttcaagaattcacaatcctttatgtaaattaagtggctttcctaaaggt
attgtggagaagaatcaaatcaacaatgttgacttatcaccaacaaaaagcattaggatt
ccacacacggataaattaccacaatatacatcttgggtatacgtggctagaaatgagaga
atggtcgatgatcaatcggttatcgggaaataccaaatgtaccatgataaaaataaaggt
gaaatggtgatatgcagtgacaatgaggaagagatagtagatcccgaggatgtcaaacat
gaattcactgaggttgaagacaaatttttgcggatgacgcttgaagaatatgggtgtact
gaggaggtattgaatgtcgttaaaaaatttgttaagactactaattcagaaattcaggag
aggtatgaaaaactcaaggaaaagaatatggagattctagaccaacattgtgaagattgt
cattgtagaggatgtgaaaatcatcttggattatgtttggaaaaaagcttgagtgttact
ttagaaactttcaataatcttttatgtcgacaatgtctgatctttgattgtcctatgcat
ggcattaataaacctttagtataccatagtgaaaaccaaccagtttggcttgaacctgaa
ggtgataagaaaccatgcagtgatcaatgttacctcatgttaaaggatgctaggattttg
tcgaaaaattcaactcaatggtcttttcaagataaagtaattacaacaatggaagaggac
tcaatattgcctcgtgatgatgaagaaaaccacacagtgtattaggcatctttgaaaagt
cttgttgaacatacttcagaaaaactaacaatttctggtagctctggccatggcgagtgt
gacaaaagagttgtggatggacaaaaagatctcataaatgggataaaacttaaccaaata
tccatttcaagggaagtgcaagctaatgggatgtcaagcgactcatattggagacctctg
gaaatggatttgtatttgaagggagtaaaaatgtttggaaaaaatagttgccttatagcc
attaccttacttcctggcttgaagacatgcttggaagtagctaggtacatgtttggtggt
ggggagttaatgaccaatggattcataccaagttcaatcatggaaaaaaatgaaaagatc
aatgcagggtgcacagaccaagaaatgtcatcaagatcacgaccgcaacgaaaaaaagga
aaacctaaaaagttcaattattctcgaaagtctgctggcctcccacctagatggcgaaaa
attgcttatgggcaaaacttgtgtaataagcaatatactccttgtgggtgccatggaata
tgtggaaaggaatgttcctgtcttgttaatggaacttgctgtgaaaaatattgcgggtgt
tcaaaacactgcagtaatcgatttagaggatgccgttgcacaaaaagtcaatgcaaaagt
cgatcatgtccatgttttgcagccaaccgtgaatgtgacccagatgtttgtcaaaattgt
tgggttagttgcggtgatgactcattggggaggctacctcgacatgaagatgctaagtgt
ggaaatatgaatcttcttttagggcaaaaagaaaggattcttttggcaaagtcagatgtt
ataggatggggagcctttgcaaagaacccaattagcaaaaatgtttgcctaggagagtac
acgggtgagctaatccctcctaaagaagcagaaaagcgtgggaaactatatgatcgcata
aacacttccttcctttttaacctcaatgaccagtgggttattgacgcttttcgcatggga
gacaagttaaaatttgcaaaccattcatcaaagcccaactgctatgcaaaggtgatgctt
gttggaggagatcatcgagtcggcatatttgccagggaaaacattaaagctggtgatgag
attttttatgactatggctatgatctagattctgcaccgctatgggctcttccacccaac
gaggcggccaagaaagacaaattagttgtttctctgagtaggacaaagaaaaaagaaaaa
aaatcagtttcatttcaataa

DBGET integrated database retrieval system