KEGG   Glycine max (soybean): 100788658Help
Entry
100788658         CDS       T01710                                 

Definition
bifunctional dihydrofolate reductase-thymidylate synthase-like
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
gmx  Glycine max (soybean)
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:gmx00240]
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:gmx00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:gmx00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 530 aa AA seqDB search
MATDALVISNGNGNGNAKSELHPQRTYQVVVVATRDMGISKDAKLPWTLPTELKFFEEIT
TTTSDPGKKNAVVMGRKTWESIPPENRPLPGRLNVVLTRSGSFDIATAENVLICGSMASA
MELLASSPYCLSIEKVFLTGGGEIFREALNAPGCEAAHITEIEASIECDTFMPRVDTNVF
QTWYSSFPLVEDNLRYSFTTYARVRSSPPEFLDQNADPFFYNNSDSFKFEVKKFSFLPKM
VYERHEEFKYLRLVQEIISEGTTKDDRTGTGTLSKFGCQMRFNLRRNFPLLTTKKVFWRG
VVEELLWFISGSTSAKALQEKGIHIWDGNASREYLDSIGLTEREKGDLGPVYGFQWRHFG
AKYTDMHADYSGQGFDQLLDVINKIKHNPNDRRIILSAWNPSDLKLMALPPCHMFAQFYV
ANGELSCQMYQRSADMGLGVPFNIASYALLTCMIAHVCDLVPGDFIHVIGDAHVYRNHVR
PLQEQLQNQPKPFPILKINPKKKDIDSFVAADFKLIGYDPHQKIEMKMAV
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgatgctcttgtgatttccaatggcaatggcaatggcaatgccaagtcagag
ctgcatccgcagaggacttaccaagtagtagtggttgcaaccagagatatgggcatttct
aaggatgcaaaactgccctggacattacctactgaactcaaattttttgaggagatcact
acaacaacatctgatccggggaagaagaatgccgttgtgatgggtaggaaaacatgggag
agcatccctcctgagaacaggccacttcctggtcgccttaatgttgttctgactcgctcg
ggtagctttgatattgcaacagcagagaatgttcttatatgtggaagtatggcttctgct
atggagctgttggcttcttctccttactgcctatcaattgagaaagtatttctcacagga
ggtggagagatatttagagaggctcttaatgcacctggatgtgaagctgcccatattaca
gaaattgaggcaagcattgagtgtgacacttttatgcctcgagttgataccaatgtattt
cagacatggtattcatctttccctttggtggaagacaacctccgctattctttcaccact
tatgcgcgtgtaaggagttctccaccagagttcctggatcagaatgctgatccatttttt
tataataattcagactctttcaaatttgaggtcaagaaattttcttttcttcccaaaatg
gtttatgagagacatgaggagtttaagtatcttaggttggttcaagaaatcatttctgaa
ggcacaactaaggatgataggacagggactggtaccttgtcgaaatttggctgccagatg
aggtttaatctgcgcagaaactttcctcttctaacaacaaagaaagtattttggcgaggg
gtagttgaagagcttctttggtttatcagtggctcaacaagtgccaaggcgctgcaggaa
aaaggcattcatatatgggatggcaatgcatccagggagtaccttgatagcattggtttg
acagaaagggagaagggtgacttaggacctgtttatgggtttcagtggaggcactttgga
gccaagtatactgacatgcatgctgactactctggccaaggatttgatcagcttttagat
gttattaacaagataaagcataatcccaatgatcgaaggatcattctctcagcgtggaat
ccatctgatcttaaattgatggcacttccaccctgccacatgtttgcacagttctatgta
gctaatggggagctatcatgtcaaatgtatcagcgatctgccgacatgggcctgggtgtc
ccatttaatattgcatcttatgcactcctgacatgcatgatcgctcatgtttgtgacctt
gttccaggtgattttatccatgttattggggatgcacatgtttaccgcaatcatgtgaga
cccttgcaggaacagctccagaaccaaccaaaaccttttccaattttgaagataaaccca
aagaagaaagatatagattcttttgtggcagctgatttcaagctcataggatatgatcct
caccagaagatagaaatgaagatggctgtttag

DBGET integrated database retrieval system