KEGG   Glycine max (soybean): 100788687Help
Entry
100788687         CDS       T01710                                 

Definition
protein disulfide-isomerase-like
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
gmx  Glycine max (soybean)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100788687
Enzymes [BR:gmx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100788687
Exosome [BR:gmx04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100788687
  Exosomal proteins of colorectal cancer cells
   100788687
  Exosomal proteins of bladder cancer cells
   100788687
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 503 aa AA seqDB search
MAGTVSTCFFFVFLLSLLLPFQISAEESSEKEFVLTLDHSNFHDTVSKHDFIVVEFYAPW
CGHCKKLAPEYEKAASILSSHDPPIVLAKVDANEEKNKDLASQYDVKGFPTINILRNGGK
NVQEYKGPREADGIVDYLKKQSGPASTEIKSADEATAFIGENKVAIVGVFPKFSGEEFDN
FSALAEKLRSDYDFGHTLNAKLLPRGESSVSGPVVRLFKPFDELFVDFQDFNVEALEKFV
EESSTPVVTVFNNEPSNHPFVVKFFNSPNAKAMLFINFTAEGAEAIKSKYREAAEQYKQQ
GVSFLVGDVESSQGAFQYFGLKEEQVPLIIIQHNDGKKFFKPNLEADHIPTWLKAYKDGH
VAPFVKSEPIPETNDEPVKVVVGASLEDIVFKSGKNVLLEFYAPWCGHCKQLAPILDEVA
ISYQNEADVVIAKLDATANDIPSETFDVQGYPTVYFRSASGKLSQYDGGRTKEDIIEFIE
KNRDKPAQQEQGKDEQEQGKDEL
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtacggtttcgacttgtttcttcttcgtgtttcttctttctctccttcttcct
tttcagatctccgctgaggaatcctcggagaaggagttcgtactcacattggatcactct
aactttcacgacactgtcagcaagcacgatttcatcgtcgtcgagttctacgccccatgg
tgtggtcactgtaagaagcttgctccggagtatgagaaagctgcttctatcttgagtagt
catgatcctcctattgttttggctaaagtagatgccaatgaggagaagaacaaagacctt
gcatcacaatatgatgttaagggattcccaacaattaatattctgagaaatgggggaaag
aatgttcaggaatacaaaggtccccgtgaagcagatggcatcgttgactatttgaagaaa
caaagtggtcctgcttcaactgaaattaaatctgctgatgaagctactgcttttattggt
gaaaataaagttgctattgttggagttttcccgaaattttctggagaggagtttgacaac
ttttctgccttagcagagaagttgcgttctgattatgactttggtcacactctgaatgcc
aaactccttccaagaggagagtcatcagtttctgggcccgtagttaggctgttcaagcca
ttcgatgaactttttgttgacttccaggatttcaatgtggaagctctagagaagtttgtt
gaggaatctagtacccctgttgttactgtctttaacaatgaaccgagcaatcaccctttc
gttgtcaaattcttcaacagtcccaacgcaaaggcaatgttgttcatcaacttcactgcc
gaaggtgctgaagctatcaaatcaaaataccgtgaagctgctgagcaatataaacaacag
ggtgtcagctttttggtgggagatgttgagtctagtcaaggtgctttccagtattttgga
ctgaaagaagagcaagtacctctaattatcattcaacataatgatgggaaaaagtttttt
aaacccaatttggaagctgatcacattccaacctggttgaaggcatacaaggatggtcat
gttgcaccatttgttaagtctgaacccattcccgagactaacgatgaacctgttaaagtg
gtagttggggccagtcttgaggacattgttttcaaatctgggaagaatgttctgctggag
ttttatgctccctggtgtggtcattgcaaacagttggctccaatattggatgaagttgct
atctcatatcaaaatgaagctgatgttgttattgcaaaactggatgcaactgccaacgat
atcccaagtgaaacctttgatgtccaaggttatcctaccgtgtacttcaggtcagcaagt
ggaaagttatcacaatacgacggcggtaggaccaaggaagacatcatagaattcatcgaa
aagaaccgggataaacctgctcagcaagaacaaggaaaagatgagcaagaacaaggaaaa
gatgagctttga

DBGET integrated database retrieval system