KEGG   Glycine max (soybean): 100788806Help
Entry
100788806         CDS       T01710                                 

Definition
asparagine synthetase [glutamine-hydrolyzing] 3-like
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
gmx  Glycine max (soybean)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:gmx00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 566 aa AA seqDB search
MCGILAVLGCVDNSQAKRARIIELSRRLRHRGPDWSGIDCYEDCYLAHQRLAIVDPTSGD
QPLYNEDKTIVVTVNGEIYNHKQLRQKLSSHQFRTGSDCEVIAHLYEEYGEEFVNMLDGM
FAFILLDTRDKSFIAARDAIGITPLYLGWGHDGSTWFASEMKALSDDCERFIAFPPGHIY
SSKQGGLRRWYNPPWFSEDIPSTPYDPILLRETFERAVVKRLMTDVPFGVLLSGGLDSSL
VASVVNRYLAESETARQWGSQLHTFCIGLKGSPDLKAAKEVADYLGTRHHELYFTVQEGI
DALEEVIYHIETYDVTTIRASTPMFLMSRKIKALGVKMVLSGEGSDEIFGGYLYFHKAPN
KKELHEETCQKIKALHLYDCLRANKSTAAWGVEARVPFLDKEFINVAMSIDPEWKMIRPD
LGRIEKWVLRNAFDDDKNPYLPKHILYRQKEQFSDGVGYSWIDGLKDHANKQVTDATMMA
ANFIYPENTPTTKEGYLYRTIFEKFFPKNSAKATVPGGPSVACSTAKAVEWDASWSKNLD
PSGRAALGVHAAAYDGAVDTTKNGPL
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatcctcgcagtgttgggttgcgtcgacaactctcaggccaagcgcgctcgc
atcatcgaattgtctcgcaggttgcggcatagaggtcctgattggagtggcatagattgc
tatgaggattgttacctagctcatcaacgccttgctattgttgaccctacttcaggggac
caacctttgtacaacgaagataagactattgttgtcactgtaaatggggagatatacaat
cacaagcaattgagacagaaactgagttcccatcaatttcgaactggtagtgattgtgaa
gtgattgcccatctttatgaagaatatggagaagaatttgttaatatgctggatgggatg
tttgcctttattcttcttgatacccgcgataaaagttttattgctgctcgtgacgctatt
ggcattacccctctatacttgggttggggtcatgatggatcaacatggtttgcatctgaa
atgaaagctctgagtgatgattgtgagagattcattgcttttcctccagggcatatatat
tccagcaaacagggaggattaagaaggtggtacaatccaccgtggttttcagaggatatt
ccatcaactccctatgatccaatccttttgcgtgagacctttgagagggctgtagttaag
agactgatgactgatgtaccttttggagttcttttgtctggaggattggactcatcactt
gttgcttctgtggtcaatcgttatttggctgaatctgaaactgctcgacaatggggatca
cagttgcatactttctgcattggtttaaagggttctcctgacttgaaagctgcaaaagag
gtagcagattatcttggtactcgtcaccatgaactttatttcacagttcaggaaggtata
gatgcacttgaagaagtcatttaccatattgaaacatatgatgtaacgactatcagagca
agtacgccaatgtttcttatgtccagaaaaattaaagccttgggagtgaaaatggttctt
tctggagaaggttcagatgaaatatttggaggttacctgtactttcacaaggcacctaac
aagaaagagcttcatgaagaaacatgtcaaaaaattaaagctcttcatctttatgactgc
ctgagagccaataaatcaactgcagcatggggtgtagaggcacgtgtaccattcttggat
aaagaatttatcaacgtagccatgagtatagatccggagtggaaaatgataaggcctgat
cttggaaggatagagaagtgggtgttacgcaatgcatttgatgatgataagaatccatat
ttaccgaagcacatattgtacaggcagaaggaacagttcagtgatggggttggttacagc
tggattgatggcttgaaggatcacgctaacaaacaagtcacagatgcaacgatgatggct
gccaattttatttaccctgaaaacactcctactacaaaagaaggatacctctacaggaca
atttttgagaagttctttccaaagaattcagcaaaggcaacagtgcctggaggtcctagt
gtggcatgcagtactgcaaaagctgtggaatgggatgcatcatggtccaaaaatcttgat
ccttctggtcgtgcagcgcttggtgttcatgcagctgcatatgatggtgcagtggataca
accaaaaatggacccctttaa

DBGET integrated database retrieval system