KEGG   Glycine max (soybean): 100788990Help
Entry
100788990         CDS       T01710                                 

Definition
(RefSeq) serine/threonine-protein kinase DCLK1-like
  KO
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
gmx  Glycine max (soybean)
Brite
Enzymes [BR:gmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100788990
Protein kinases [BR:gmx01001]
 Serine/threonine protein kinases: Other group
  TTK family
   100788990
Chromosome [BR:gmx03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     100788990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
4
AA seq 752 aa AA seqDB search
MDGKPNPDSSSTDLLRDVQAALKRHRPLGTMQSNCIRPKRPLLPQRASNISSSSDATNSQ
EEASSKDSLITVVPAQNLDAQKKVQFSVRSNAALQDGKATELENLSSHMSSLGFAEMEWV
EGSQIESSSSSSLGCIQLENVPQAAFDASLKCESGVSSVLPKRSLVTQDHLQQFRSFLSQ
PATQSSVVGPSCATTTSVHSTSAPMLNSATRYSHLRQDGGSSVAAEPLGEVNANPCPITE
GVXKSVDVSIKETNRMSVDRGAEAEVRASGSCIDDAGLLSKGSNRSKEQQGGVLKESGNS
KYTSCDDAKGKEAVDVATVQTQAPLPTTITSSSDMKLGSSKEEKREKTASSKGASGTRKR
TYDPDLFFKVNGKLYQRLGKIGSGGSSEVHKVISSDCRIYALKKIKLKGRDYATAYGFCQ
EIEYLNRLKGKDNIIQLIDYEVTDKALLEEVMKGSFSNKDGRVKDDGCIYMVLEYGEIDL
AHMLSQKWKELDGNNKTIDENWLRFYWQQILLAVNTIHEERIVHSDLKPANFLLVKGSLK
LIDFGIAKAIMSDTTNIQRDSQVGTLSYMSPEAFLCNETDANGNIIKCGRPSDIWSLGCI
LYQMVYGRTPFSDYKTFWAKFKVITDPNHKITYEPVSNPWLLDLMKRCLAWDRNQRWRIP
QLLQHPFLVPPVPSNPSLPQDHTCKLLQLISETCTYDPEATQLCSQLQRLLSDPLEKTTC
SLYSRDQQLKLLSQMSELCIQLHERLTNTENK
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atggatgggaagcctaacccggattcctcctccacggacctcctccgcgacgttcaagcc
gccttgaaacgacaccgtcctctcggtacaatgcagtccaattgcataaggccaaagcgc
ccgctacttcctcaaagagcatcaaacatttcttcttcttccgatgccaccaattctcaa
gaggaagcttcttccaaggattcgcttataaccgtcgtccctgctcaaaacctagacgct
cagaagaaagtccagttttcagttcgaagcaacgctgccttgcaggatggaaaggccact
gagttggagaatttatcttctcacatgagttcgcttggattcgcagaaatggagtgggtt
gaaggcagtcaaattgaatcatcctcatcgtcgtcgcttggatgcatccagctggagaat
gttccgcaggcagcgtttgacgcgagtttgaaatgtgaaagtggagtgagttccgtgcta
ccgaagagaagtttggttacccaggatcatttgcagcaattcagaagttttttgagtcag
cccgcgacacaatcttcggtggtgggaccttcttgtgctacaactacctcggttcattca
acttctgcaccaatgctaaattcagcaacacgatattctcatttgcgtcaagatggtggc
tcaagtgtggctgctgagcctttgggggaggttaatgctaatccttgtcctataactgaa
ggggttngtaaatcggttgatgtttccataaaagaaacgaatagaatgtcggttgatcgg
ggggcagaagctgaagtccgagcttccggttcttgtattgatgatgcagggttgttatct
aaggggagcaatcgatctaaggagcaacaagggggtgtgttgaaggaatctggcaattct
aaatatacttcttgtgatgatgcgaaagggaaagaggctgtggatgttgccactgtacaa
acacaggctccacttcccacaaccataacctcatcttcagatatgaagttggggtcttct
aaggaggaaaaacgtgagaagactgcaagtagtaaaggtgcatcgggtacccggaaaaga
acttatgaccctgatttgtttttcaaagtcaacggcaagctttatcagcgtcttggcaag
ataggtagtggtggaagcagtgaggtgcacaaagtgatctcatcggactgtaggatatat
gcacttaaaaagatcaagctcaagggacgtgattatgctactgcatatgggttttgtcaa
gaaattgagtatctaaataggctgaagggaaaggataacatcatacagcttatagattat
gaggtgactgacaaggctttacttgaggaagttatgaaaggctccttcagtaataaggat
ggcagggtcaaggatgatggatgtatatacatggtgcttgaatatggggaaatcgatttg
gctcacatgttgtctcagaagtggaaggaactggatggaaacaacaaaactatagacgag
aactggcttcgattttattggcagcaaattcttctagctgtcaacactattcatgaggaa
cgaattgtgcactcagacttgaagccagctaacttcctccttgtcaaaggttccctaaaa
ctgattgattttggtatagccaaagcaataatgagtgacacaaccaacatccaacgggat
tcacaggtgggcactctaagttacatgtctccagaagcatttttgtgtaacgagactgat
gcgaatggaaacatcataaagtgtggccgaccatcagatatctggtccctgggctgcatc
ctttatcaaatggtatatgggaggacacctttttctgattacaagacattttgggcgaaa
ttcaaagttataacagatccaaatcataaaattacgtatgaaccagtttcaaacccatgg
cttttggatcttatgaagaggtgtctagcatgggatcgcaatcaaaggtggagaattcct
cagctactccaacatccttttcttgttcctcctgtaccatctaatccatctttgccccaa
gatcatacctgtaaattgctacaacttatttctgaaacttgtacatatgaccctgaagca
acccaactgtgtagtcagctccaacggcttcttagtgacccacttgagaaaacaacttgc
tcactatattcacgagatcaacagctaaaactgctgtcccaaatgtcagaactctgtatt
cagctgcacgaacgtttgacaaatactgaaaacaagtag

DBGET integrated database retrieval system