KEGG   Glycine max (soybean): 100788990Help
Entry
100788990         CDS       T01710                                 

Definition
(RefSeq) serine/threonine-protein kinase DCLK1-like
Organism
gmx  Glycine max (soybean)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
4
AA seq 752 aa AA seqDB search
MDGKPNPDSSSTDLLRDVQAALKRHRPLGTMQSNCIRPKRPLLPQRASNISSSSDATNSQ
EEASSKDSLITVVPAQNLDAQKKVQFSVRSNAALQDGKATELENLSSHMSSLGFAEMEWV
EGSQIESSSSSSLGCIQLENVPQAAFDASLKCESGVSSVLPKRSLVTQDHLQQFRSFLSQ
PATQSSVVGPSCATTTSVHSTSAPMLNSATRYSHLRQDGGSSVAAEPLGEVNANPCPITE
GVXKSVDVSIKETNRMSVDRGAEAEVRASGSCIDDAGLLSKGSNRSKEQQGGVLKESGNS
KYTSCDDAKGKEAVDVATVQTQAPLPTTITSSSDMKLGSSKEEKREKTASSKGASGTRKR
TYDPDLFFKVNGKLYQRLGKIGSGGSSEVHKVISSDCRIYALKKIKLKGRDYATAYGFCQ
EIEYLNRLKGKDNIIQLIDYEVTDKALLEEVMKGSFSNKDGRVKDDGCIYMVLEYGEIDL
AHMLSQKWKELDGNNKTIDENWLRFYWQQILLAVNTIHEERIVHSDLKPANFLLVKGSLK
LIDFGIAKAIMSDTTNIQRDSQVGTLSYMSPEAFLCNETDANGNIIKCGRPSDIWSLGCI
LYQMVYGRTPFSDYKTFWAKFKVITDPNHKITYEPVSNPWLLDLMKRCLAWDRNQRWRIP
QLLQHPFLVPPVPSNPSLPQDHTCKLLQLISETCTYDPEATQLCSQLQRLLSDPLEKTTC
SLYSRDQQLKLLSQMSELCIQLHERLTNTENK
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atggatgggaagcctaacccggattcctcctccacggacctcctccgcgacgttcaagcc
gccttgaaacgacaccgtcctctcggtacaatgcagtccaattgcataaggccaaagcgc
ccgctacttcctcaaagagcatcaaacatttcttcttcttccgatgccaccaattctcaa
gaggaagcttcttccaaggattcgcttataaccgtcgtccctgctcaaaacctagacgct
cagaagaaagtccagttttcagttcgaagcaacgctgccttgcaggatggaaaggccact
gagttggagaatttatcttctcacatgagttcgcttggattcgcagaaatggagtgggtt
gaaggcagtcaaattgaatcatcctcatcgtcgtcgcttggatgcatccagctggagaat
gttccgcaggcagcgtttgacgcgagtttgaaatgtgaaagtggagtgagttccgtgcta
ccgaagagaagtttggttacccaggatcatttgcagcaattcagaagttttttgagtcag
cccgcgacacaatcttcggtggtgggaccttcttgtgctacaactacctcggttcattca
acttctgcaccaatgctaaattcagcaacacgatattctcatttgcgtcaagatggtggc
tcaagtgtggctgctgagcctttgggggaggttaatgctaatccttgtcctataactgaa
ggggttngtaaatcggttgatgtttccataaaagaaacgaatagaatgtcggttgatcgg
ggggcagaagctgaagtccgagcttccggttcttgtattgatgatgcagggttgttatct
aaggggagcaatcgatctaaggagcaacaagggggtgtgttgaaggaatctggcaattct
aaatatacttcttgtgatgatgcgaaagggaaagaggctgtggatgttgccactgtacaa
acacaggctccacttcccacaaccataacctcatcttcagatatgaagttggggtcttct
aaggaggaaaaacgtgagaagactgcaagtagtaaaggtgcatcgggtacccggaaaaga
acttatgaccctgatttgtttttcaaagtcaacggcaagctttatcagcgtcttggcaag
ataggtagtggtggaagcagtgaggtgcacaaagtgatctcatcggactgtaggatatat
gcacttaaaaagatcaagctcaagggacgtgattatgctactgcatatgggttttgtcaa
gaaattgagtatctaaataggctgaagggaaaggataacatcatacagcttatagattat
gaggtgactgacaaggctttacttgaggaagttatgaaaggctccttcagtaataaggat
ggcagggtcaaggatgatggatgtatatacatggtgcttgaatatggggaaatcgatttg
gctcacatgttgtctcagaagtggaaggaactggatggaaacaacaaaactatagacgag
aactggcttcgattttattggcagcaaattcttctagctgtcaacactattcatgaggaa
cgaattgtgcactcagacttgaagccagctaacttcctccttgtcaaaggttccctaaaa
ctgattgattttggtatagccaaagcaataatgagtgacacaaccaacatccaacgggat
tcacaggtgggcactctaagttacatgtctccagaagcatttttgtgtaacgagactgat
gcgaatggaaacatcataaagtgtggccgaccatcagatatctggtccctgggctgcatc
ctttatcaaatggtatatgggaggacacctttttctgattacaagacattttgggcgaaa
ttcaaagttataacagatccaaatcataaaattacgtatgaaccagtttcaaacccatgg
cttttggatcttatgaagaggtgtctagcatgggatcgcaatcaaaggtggagaattcct
cagctactccaacatccttttcttgttcctcctgtaccatctaatccatctttgccccaa
gatcatacctgtaaattgctacaacttatttctgaaacttgtacatatgaccctgaagca
acccaactgtgtagtcagctccaacggcttcttagtgacccacttgagaaaacaacttgc
tcactatattcacgagatcaacagctaaaactgctgtcccaaatgtcagaactctgtatt
cagctgcacgaacgtttgacaaatactgaaaacaagtag

DBGET integrated database retrieval system