KEGG   Glycine max (soybean): 100789036Help
Entry
100789036         CDS       T01710                                 

Gene name
ICL1, ICL
Definition
isocitrate lyase 1-like (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
gmx  Glycine max (soybean)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100789036 (ICL1)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    100789036 (ICL1)
Enzymes [BR:gmx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     100789036 (ICL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 576 aa AA seqDB search
MAASLFMPSSIVEEEARFEAEVAEVQAWWNSERFRLTKRPYTARDVVSLRGNLRQTYASN
EMAKKLWRLLKNHQANGTASRTFGALDPVQVTQMAKHLDTIYVSGWQCSATHTTSNEPGP
DLADYPYDTVPNKVEHLFFAQQYHDRKQKEERMRMSREERARTPYVDYLRPIIADGDTGF
GGTTATVKLCKLFVERGAAGIHIEDQSSVTKKCGHMAGKVLVAISEHINRLVAARLQFDV
MGVETVLVARTDAEAANLIQSNIDTRDHQFILGVTNPNLKGKSLATLMQQGMAAGKNGAE
LQALEDEWLSKAQLKTLSEAVVEAIERQNNIGEEEKRRKLNEWMHHSSYERCLSNEEGRE
IAEKLGVRNLFWDWDLPRTREGFYRFKGSVTASVVRGCAFSPHADVIWMETASPNVVECT
EFSEGVRSKHPQMMLGYNLSPSFNWDASGMSDEQMKDFIPKIAKLGYVWQFITVGGLHSN
ALITSTFARDFANRGMLAYVERIQREERNNGVDTLAHQKWAGANYYDRYLKTVQGGVAST
AAMGKGVTEEQFKESWTRSGAVNIDRGSIVVAKARM
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggctgcatcattatttatgccttcatccatagtggaggaagaagcgaggttcgaagcc
gaagtggcggaggtgcaagcatggtggaactctgagaggttcaggctaacaaaaaggcca
tacacagcaagagatgtagtgtccctccgaggcaacctcagacaaacctatgcctcgaac
gagatggcgaaaaagctatggcgcctcctgaagaaccaccaagctaatggaacagcctcg
aggacttttggtgcacttgatcctgttcaggtcacccaaatggccaagcacttggatacg
atctatgtctcagggtggcagtgttcagccacacacaccacgagcaacgagcccggtcct
gaccttgctgattacccttatgacactgtcccaaacaaggttgagcacctcttctttgct
cagcagtaccatgacaggaagcaaaaagaggagaggatgagaatgagcagggaagagagg
gcaaggacaccttatgttgattacttgaggccaatcatagctgatggtgacactggcttt
ggtggcaccacagcaactgtcaagctatgcaagctctttgttgagagaggtgctgctgga
atccacattgaggaccagtcttcagtgaccaaaaaatgtggtcacatggctgggaaagtg
cttgttgccatcagtgaacacatcaacaggcttgtggctgcaaggcttcagtttgatgtc
atgggggtggaaactgttctggtggcaagaacagatgcagaagctgctaatttgattcaa
tcaaacattgacacaagggaccatcaatttatcttgggagtgaccaaccccaaccttaag
gggaagagcttagcaactcttatgcaacaaggcatggctgctggaaaaaatggagctgag
cttcaggctttggaggatgagtggctctcaaaggcacagttgaagactctctcagaagca
gttgtggaggcaattgagaggcagaacaacattggagaggaagaaaaaagaaggaagcta
aatgagtggatgcaccattcaagctatgaaaggtgcctttctaatgaggaaggtagggaa
attgctgaaaagttaggagtgagaaacctcttttgggattgggacttgcctaggactaga
gaaggtttttataggttcaaaggttcagtgactgcatcagttgttagaggttgtgctttt
tctccacatgctgatgttatatggatggagactgcaagcccaaatgtggttgagtgcaca
gagttttccgagggggttaggtcaaagcaccctcagatgatgcttggatacaacctctct
ccatctttcaactgggatgcttctggaatgagtgatgaacaaatgaaggatttcattcca
aagattgcaaagttggggtatgtgtggcagttcatcactgtgggaggtcttcattccaat
gcactcataacttcaacatttgcaagggattttgccaataggggaatgctggcttatgtg
gagaggattcagagagaggagaggaacaatggggttgacacactagctcaccaaaaatgg
gctggtgctaattactatgataggtacctcaagactgtccagggaggtgtggcttcaact
gctgcaatgggaaaaggagtaactgaagagcagtttaaagaatcatggactagatcagga
gctgtaaacattgatagaggcagtattgtggttgctaaggccagaatgtga

DBGET integrated database retrieval system