KEGG   Glycine max (soybean): 100789257Help
Entry
100789257         CDS       T01710                                 

Definition
acetate--CoA ligase ACS, chloroplastic/glyoxysomal-like
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
gmx  Glycine max (soybean)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:gmx01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:gmx00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:gmx00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:gmx00640]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
16
AA seq 752 aa AA seqDB search
MIPLSHNSVSVHLGGVPCDPLHPIAFDPTLNKPCSSTSLFWNCKRRRKRKNSIIMASNLR
TNNFLRHVESMKLLPSGAGHISHLNAVILGESLATEEDDFVLPSEDFAGQANVQSPEQYL
KMYKRSIEDPAGFWSEIASEFYWKQRWGDKVCDENFDVRKGNIKIEWFKGGITNICYNCL
DRNVEAGLGDKVAVYWEGNEPGLDGTLTYTQLLQQVCQLANYLKDIGVKKGDAVIIYLPM
LMELPIAMLACARIGAVHSVVFAGFSAEALSQRIIDCKPKVVITCNAVKRGSKPIYLKDI
VDAAINDSSQNGVSIDKCLVYENPLAMKRVDTKWKEGRDIWWQDVIHQYPTTCPVEWVDA
EDPLFLLYTSGSTGKPKGVLHTTGGYMVYTATTFKYAFDYKPHDIYWCTADCGWITGHSY
VTYGPMLNGASVIVYEGAPNYPDAGRCWDIVDKYKVTIFYTAPTLVRSLMRDGDTFVTRY
SRKSLRVLGSVGEPINPSAWRWFYNVVGDSRCPISDTWWQTETGGFMITPLPGAWPQKPG
SATLPFFGVQPVIVDEKGVEIEGECNGYLCVKKSWPGAFRTLYGDHERYETTYFKPFSGY
YFSGDGCSRDKDGYHWLTGRVDDVINVSGHRIGTAEVESALVSHPQCAEAAVVGVEHEVK
GQGIYAFVTVVDGVPYSEELRKDLVLTVRKQIGAFAAPDKIHWAPGLPKTRSGKIMRRIL
RKIASRQLDELGDTSTLSDPNVVNQLIELADS
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgattcctctgtcccataactcagtctctgttcacctgggtggagtaccctgtgaccct
cttcacccaattgcgttcgatcccactctgaacaagccttgttcttccacctctctgttt
tggaactgcaagaggagaaggaagaggaaaaactccattatcatggcctctaatctcagg
accaacaatttcctgcgccatgtggaatcaatgaagcttcttccatcaggtgctggccac
atttcgcacctgaacgctgtgatacttggtgaatctctcgccactgaagaggatgatttc
gttcttccaagtgaggactttgctggccaagccaatgttcagtccccagaacagtatctg
aagatgtataagagatcgattgaggaccctgctggattctggtctgagattgcctcagag
ttctattggaaacagagatggggtgacaaagtgtgtgatgaaaattttgatgtaaggaaa
gggaatataaagattgagtggttcaagggtggcatcaccaacatctgttataattgcttg
gatagaaatgttgaagctggacttggtgacaaggtcgccgtttactgggaaggcaatgag
cctggtttggatggtactttgacatacactcagcttctccagcaagtttgccagcttgca
aactaccttaaagatattggcgtgaagaagggagatgctgtaattatttatttgcccatg
cttatggagcttcccatcgcaatgcttgcctgtgcccggattggtgctgttcattcggtt
gtatttgctggtttttctgcagaagctctttcccagagaatcattgattgtaaaccaaaa
gttgtaattacttgcaatgctgttaaaaggggctctaagcctatctatctgaaagatatt
gttgatgctgcaatcaatgattcatcccaaaatggggtttctatagataaatgcctagtt
tatgaaaacccattagcaatgaagagggtagataccaaatggaaggaagggcgtgatata
tggtggcaggatgtcattcatcaatatccaactacttgtccagtggagtgggttgatgca
gaggatccactttttctactctatacaagtgggagtacaggaaaaccaaagggtgtcctc
catacaactggtggttacatggtgtacactgcaacaacattcaagtatgcatttgactac
aagccgcatgacatctactggtgtactgctgattgtggttggattactgggcacagctat
gtcacttatggacccatgctcaatggtgcatctgtcatcgtgtatgaaggggctcctaat
tatcctgatgctgggagatgttgggacattgttgacaaatataaggtgacaatattctac
actgctcctacattggtgcggtccctcatgcgtgatggtgacacgtttgttactcgctac
tcaaggaaatctttacgagtcctaggaagtgtaggcgagcccataaatccaagtgcatgg
aggtggttttacaatgtagttggagattcaaggtgccctatctctgacacttggtggcaa
acagaaacgggtggcttcatgataactccactaccaggtgcttggccccagaaacctggt
tctgcaactctccctttctttggagttcagccagtcattgtggatgagaaaggtgttgaa
atagaaggagagtgcaatggatatttgtgtgtgaagaaatcatggcccggggcattcaga
actctgtatggtgatcatgaaagatatgaaacaacatatttcaagccattttccggatac
tatttcagtggtgatggttgcagcagggataaagatggataccattggctcactggaaga
gttgatgatgttatcaatgttagtgggcatcgaattggcacagcagaagtggaatcagct
ttagtttcacatccgcaatgtgcagaggctgctgtggttggtgtggagcatgaggtcaaa
ggacagggcatctatgcatttgttacagttgtggatggtgttccttacagtgaagaactg
cggaaggaccttgtactcacagttcgaaagcagataggagcctttgcagcgcctgacaaa
attcattgggcacctggccttccaaaaacaaggagtggaaagataatgcgaagaattctg
agaaaaattgcttcccggcagctggatgaacttggagatacaagtaccctttcagatcca
aatgtggtcaatcaacttatagaacttgcagattcttga

DBGET integrated database retrieval system