KEGG   Glycine max (soybean): 100789632Help
Entry
100789632         CDS       T01710                                 

Definition
ubiquitin carboxyl-terminal hydrolase 22-like
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
gmx  Glycine max (soybean)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
17
AA seq 555 aa AA seqDB search
MLLRNPSLYTNPEPCQHLAEYKLKHGFDGYKAIQKLLVISPIGKASVKKPNTKVPRCGFC
NGCEGRFYLCLICSSFSCLDHTLLHPQSETGHAVFVDIERAELFCGVCRDQLYDPDFDQV
VMSKHSLGVASGVTGNESIGQRLIKRRRLASGVVGLDLQKSKCRVSTKDLREKSCYPVGL
RGLNNLGSTCFMNSVLQVLLNAPPFRDYFLSGGHRLEACHHRRTADLMCCLLCDVNAIFS
AAYSGDRSPYSPAQFLYSWWQHSANLACYEQQDAHEFFISMLDAIHEKESKTRNGSKGNG
DCQCIAHKVFYGLLRSDVTCMACGFTSTTYDPCVDISLNLDTNVSSTEKGKKLTKQNEDG
SMSTLFGCLDLFTRPEKLGSDQKLYCRNCRERQDSLKQMSIRKLPLVLSLHVKRFEHSFV
KKSSRKIDRYLHFPFSLDMSPYLSSSILRARYGNRIFNFGGDQSDMFSEFEIFAVVTHSG
TLESGHYVSFVRLRNQWYRCDDAWITVVDEATVRASQCYMIFYVQKLQHNKANEDPSHVP
NSPGRELFLPIAGFC
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgttgctaagaaacccttctttatacacaaacccagaaccctgccagcaccttgctgag
tacaagctcaagcatggcttcgatggctacaaagccatccaaaagctccttgtgatttct
ccaattgggaaagccagtgtcaagaaacccaacacaaaggtacccagatgcggtttctgt
aatgggtgtgaagggagattctatctatgcctgatttgttcttcattttcatgtttggat
cacacccttttgcaccctcaatcagaaacaggtcatgctgtctttgtggacattgaaagg
gctgaacttttttgtggggtgtgccgtgatcaattgtatgaccctgattttgaccaagtt
gtgatgtctaagcactcattgggggtggcaagtggtgtcactgggaatgaaagcattggc
cagagattgatcaagaggaggagattggcttctggtgttgttggattggatttgcagaaa
tctaagtgtagagtttccaccaaagatctgagggaaaaatcgtgttaccctgtggggttg
agggggttgaacaatcttggtagcacgtgcttcatgaattcggtgttgcaagtgttgcta
aatgcacctcctttcagggactatttcctgagtggtggacaccggttggaggcttgtcat
cacagaagaaccgcggatctgatgtgttgtttgctttgtgatgtcaatgctattttttcg
gctgcgtattcgggggatcggagtccgtatagtcctgctcagtttctctacagctggtgg
cagcattcagcaaatttagcatgttatgagcagcaggatgctcacgagtttttcatttcg
atgttagatgctatccatgagaaagagagcaaaacaaggaatggaagcaaaggtaatgga
gactgtcaatgcattgctcataaggtgttctatgggttattgagatcagatgttacctgc
atggcctgtggattcacctcaacaacctatgacccttgtgtggacatttcacttaacttg
gataccaatgtctcttcaacagaaaagggtaaaaaacttaccaaacaaaatgaggatggc
agtatgtctacactttttggttgtttagatttattcacaaggccagagaagttggggtca
gaccagaaactttactgccggaattgtcgggaaaggcaggactcgttgaagcaaatgtct
attagaaagcttccattagtacttagtttgcatgtaaaacgatttgaacactcctttgtt
aaaaagtcttcaagaaaaatagatcgctacctacacttcccattttccttagatatgtcc
ccatatctgtcctcctcaatcctcagagccagatatggaaatagaatttttaattttggg
ggtgatcaatcagatatgttttctgagtttgagatttttgcagtggtgacacattcgggg
acgctcgagtctggccattatgtttctttcgtgcgtttaaggaatcagtggtacagatgt
gatgatgcttggataactgtggttgatgaggctacagtcagagcctcacagtgttacatg
attttttatgtgcaaaagttgcagcacaataaagcaaatgaagacccgagtcatgtgcca
aattcccccggaagagagctatttcttcctattgctggattttgctag

DBGET integrated database retrieval system