KEGG   Glycine max (soybean): 100789734Help
Entry
100789734         CDS       T01710                                 

Definition
mitogen-activated protein kinase kinase 2-like
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
gmx  Glycine max (soybean)
Pathway
Plant-pathogen interaction
Class
Organismal Systems; Environmental adaptation; Plant-pathogen interaction [PATH:gmx04626]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 356 aa AA seqDB search
MKKGNLGLGLKLSVPVSDQSNFARFLTESGTFKDGDLLVNRDGVRIVSQNDVEAPPPIKP
TDNQLTLADIDVIKVVGKGNGGVVQLVQHKWTSQFFALKVIQMNIEESMRKQIAQELKIN
QQAQCPYVVVCYQSFYENGVISIILEYMDGGSLADLLKKVKTIPEDYLAAICKQVLKGLV
YLHHEKHIIHRDLKPSNLLINHIGEVKITDFGVSAIMESTSGQANTFIGTYNYMSPERIN
GSQRGYNYKSDIWSLGLILLECALGRFPYAPPDQSETWESIFELIETIVDKPPPIPPSEQ
FSTEFCSFISACLQKDPKDRLSAQELMAHPFVNMYDDLEVDLSAYFSNAGSPLATL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaggaaacttgggacttggtctcaaactctcagttcctgtgtctgatcaatct
aattttgccaggttcctgactgaaagtgggacttttaaggatggggatctgcttgtcaac
agggatggagttcgaattgtctctcagaatgatgtcgaagctccacctccaatcaagcct
acagacaaccagttaactttggcagacatagatgtaatcaaagttgttggaaagggaaat
ggaggggtagttcaattggtgcaacacaaatggactagtcagttttttgcgttgaaggta
attcagatgaatattgaggagtctatgcgcaagcagattgcacaagagctgaaaattaat
caacaagcacaatgtccttatgttgttgtctgctaccaatcattctatgaaaacggtgtc
atatcaatcatcttagagtacatggatggaggttccttagctgatctgctgaagaaagtt
aaaacaattccagaggattatcttgctgccatctgtaagcaggtgctgaagggtttagtt
tatctccaccacgaaaagcatattatccacagagacttaaaaccttctaatttgttaata
aatcatattggtgaagtaaagattactgactttggtgtgagtgcaattatggaaagtaca
tctggtcaagcaaatactttcattggaacctacaactatatgtctccagagagaatcaat
ggaagccagcgaggctacaactacaaaagtgatatatggagtttgggactaatattactt
gagtgtgctttgggtcggtttccatatgcaccgcctgatcaaagtgaaacatgggaaagc
atttttgagcttattgaaaccattgtcgataaacctcctcctatccctccttctgaacaa
ttttctacagaattttgctcatttatctcagcatgtctacagaaagacccaaaggatcga
ctgtcagctcaggaattaatggcacatccttttgtcaacatgtatgatgacttggaggtg
gatctttcagcttacttctcaaatgcaggatctcctcttgcaaccttataa

DBGET integrated database retrieval system