KEGG   Glycine max (soybean): 100789756Help
Entry
100789756         CDS       T01710                                 

Definition
replication protein A 32 kDa subunit A-like
Orthology
K10739  
replication factor A2
Organism
gmx  Glycine max (soybean)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    100789756
   03420 Nucleotide excision repair
    100789756
   03430 Mismatch repair
    100789756
   03440 Homologous recombination
    100789756
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 292 aa AA seqDB search
MTNTSNSLSFSLSRVSKMFSGSQFDATTAFSGGGFTSSQPSTLNDSSPAPSNSRETPGLV
PVTVKQISEASQSGDEKSNFVINGVDLNNVTLVGMMFEKVERNTDVSFVLDDGTGRIKCR
RWINEAFDTKEMEAVMNDMYVRVYGHLKSFQGVKQLVAFSVRPVTNFDEIPFHFIDCIHN
HLRSKIKVEGITSANPSSGSSLETPVKSAPNRSQASNPVCAQHSVDGLKGIDKLVMDYLE
QHSDRSDGRGIHVDELSRELKLPIEKIKLSLKTLADDGEIYSTIDDDHYKKA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacacttccaattctctttctttctccctctctagggtttcgaagatgttctcg
ggatcccaattcgacgccaccaccgccttctccggaggcggtttcacgtcctcccagccg
tctaccctcaacgattcttctcccgcgccgtcaaacagccgcgaaactccgggtttggtg
ccggtgacagtgaagcagataagcgaggcctctcaatccggtgatgaaaagtcgaatttc
gtgatcaacggtgtagatctgaacaatgtaacactggttgggatgatgtttgagaaagtt
gagagaaatactgatgtcagttttgttttggatgatggaacaggacgaatcaaatgtcga
agatggattaatgaggcttttgacacaaaggaaatggaggcagtgatgaatgatatgtac
gttcgtgtttatgggcatttgaaaagctttcaaggtgttaagcaacttgttgccttctct
gtcaggcctgtgacaaattttgatgagatcccttttcactttattgattgcatccataac
catcttcgctccaaaataaaggtggaaggaatcacttctgcaaatccttcatctggctca
tctttggaaactcctgtcaaaagtgcaccaaatagatctcaggcatcaaatccagtatgt
gcacaacatagcgtggatggacttaagggtattgataaattggttatggactacctggag
cagcattcagataggtcagatggacgtggaatacatgttgatgaactatcacgggagctc
aagcttccaattgaaaagatcaagttgtcgctgaagactcttgcagatgatggtgaaata
tactccaccatagatgacgaccattacaaaaaagcctga

DBGET integrated database retrieval system