KEGG   Glycine max (soybean): 100789799Help
Entry
100789799         CDS       T01710                                 

Definition
arginase 1, mitochondrial-like
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
gmx  Glycine max (soybean)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    100789799
  Amino acid metabolism
   00330 Arginine and proline metabolism
    100789799
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     100789799
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 338 aa AA seqDB search
MSIISRRGICYMPRLDAAKVSAALLEKGQNRVIDASLTLIRERAKLKGELVRALGGAKAT
STLLGVPLGHNSSFLQGPAFAPPRIREAIWCGSTNSTTEEGKELQDARVLTDVGDVPIQE
IRDCGVDDHRLMNVIGESVKLVMEEDPLRPLVLGGDHSISFPVIRAVSEKHGGPVDVLHL
DAHPDNYDAFEGNIYSHASSFARVMEGDYVRRLLQVGIRSITAEGRAQAKKFGVEQYEMR
TFSRDRHFLENLKLGEGVKGVYISIDVDCLDPAFAPGVSHIEPGGLSFRDVLNILHNLQG
DVIAGDVVELNPQRDTVDGMTAMVAAKLVRELAAKISK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattatatcacgcagaggcatctgttacatgccaagactagatgcagcaaaagta
tctgctgctttgctagagaaaggccaaaatcgtgtcatagatgcttcacttacacttatt
cgagaaagagcaaagcttaagggagaacttgtgcgtgctttgggaggtgctaaagcaact
tcaactcttcttggagttcctttgggacataattcatcgttccttcaagggcctgcattt
gcacctcctcgcattagggaggccatttggtgtggtagcacaaactcaacaactgaagaa
ggcaaggaattacaagatgcacgagtgctaactgatgttggtgatgttcctatccaagaa
attcgagattgtggggtagatgatcatagattaatgaatgtaattggtgaatctgtaaag
ttagtgatggaggaggatccattacgtccattagttttaggcggtgatcactcaatatca
tttccagttatcagagctgtctctgagaagcatggaggaccagttgatgttcttcatctt
gatgcgcatcctgataactatgatgcctttgaaggaaacatttattcacatgcttcttct
tttgctcgagtcatggagggtgactatgttcgacgtctcttgcaggtcggtataagatca
ataacagctgaagggcgtgcacaagccaaaaaatttggtgttgagcaatatgaaatgcga
acattttcaagagatcgccactttttagagaacctgaaactaggggaaggtgttaaaggt
gtatatatctcaatagatgtggattgtctcgatcccgcctttgctccaggagtgtctcac
atagagccaggaggtctttcttttcgtgatgttctcaacatcctgcacaatcttcaaggt
gatgttattgctggagatgtggtcgaattaaacccacaacgtgacaccgttgatggaatg
actgccatggtagctgctaagctggtccgagaactggctgcaaagatttctaaatga

DBGET integrated database retrieval system