KEGG   Glycine max (soybean): 100790112Help
Entry
100790112         CDS       T01710                                 

Definition
(RefSeq) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00040  Pentose and glucuronate interconversions
gmx00052  Galactose metabolism
gmx00500  Starch and sucrose metabolism
gmx00520  Amino sugar and nucleotide sugar metabolism
gmx01100  Metabolic pathways
Module
gmx_M00361  Nucleotide sugar biosynthesis, eukaryotes
gmx_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100790112
   00052 Galactose metabolism
    100790112
   00500 Starch and sucrose metabolism
    100790112
   00520 Amino sugar and nucleotide sugar metabolism
    100790112
Enzymes [BR:gmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     100790112
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGP
Motif
Other DBs
NCBI-GeneID: 100790112
NCBI-ProteinID: XP_003544964
UniProt: I1MBR7
Position
14
AA seq 469 aa AA seqDB search
MATAAEKLSALKSAVAGLNEISENEKNGFISLVGRYLSGEAQHVEWSKIQTPTDEVVVPY
DTLAPTPEGSSEVKNLLDKLVVLKLNGGLGTTMGCTGPKSVIEVRDGLTFLDLIVIQIEN
LNSKYGSNVPLLLMNSFNTHDDTQKIVEKYQNSNIEIHTFNQSQYPRLVVEDFLPLPSKG
HTDKDGWYPPGHGDVFPSLLNSGKLDALLSQGKEYVFVANSDNLGAIVDLKILNHLIQNK
NEYCMEVTPKTLADVKGGTLISYEGRVQLLEIAQVPDEHVNEFKSIEKFKIFNTNNLWVN
LNAVKRLVEADALKMEIIPNPKEVDGIKVLQLETAAGAAIRFFDKAIGINVPRSRFLPVK
ATSDLLLVQSDLYTLEDGFVIRNKARENPENPSIELGPEFKKVSNFLGRFKSIPSIVELD
SLKVAGDVWFGAGVILKGKVSIVSKPGVKLEVPDGVAIVDKEINGPEDL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgctgccgagaaactctccgctctcaaatccgccgtcgccggattgaacgaa
atcagtgagaatgagaagaacggattcatcagcctcgtcggccgctatctcagtggcgaa
gcgcagcatgtggaatggagcaagatccagacgcctacggacgaagtggttgtgccttac
gacactttggcgccaactcctgaaggttcttcggaggtgaagaatctattggacaagctt
gtggtgttgaagctaaatggaggcttgggaacaactatgggttgcactggtcctaaatct
gtaattgaagttcgtgatgggttgacatttctagatttaattgtcatccaaattgagaat
ctcaattccaaatatggaagcaatgttcctttgcttttgatgaattcattcaacactcat
gatgacactcaaaagattgttgaaaaataccaaaactcaaatattgagattcatactttt
aaccagagccagtatcctcgattggttgttgaggactttttgccattgccttccaaaggg
catactgacaaggatggatggtaccctcctggccatggtgatgtcttcccatcattattg
aacagtggcaaacttgatgcactattgtcacagggtaaagagtatgtgtttgttgccaat
tcggataacttgggagctatagttgacttgaaaatcttgaatcatttgatccagaacaag
aatgaatactgtatggaggtgactcccaaaacattggctgatgtaaagggtggcactttg
atttcttacgaaggaagggttcagctcctggaaattgcacaagtccccgatgaacatgtc
aatgagttcaagtcaatagagaagttcaaaattttcaacacaaataatttgtgggtgaac
ttaaacgcagttaaaaggcttgttgaagctgatgctcttaagatggaaattattcccaat
ccaaaggaagttgacggaataaaagttcttcagctggaaactgcagctggtgctgcaata
aggttctttgacaaggctattgggattaatgttcctcgatcacgattccttcctgtgaag
gcaacttcagatttgcttcttgtccagtctgacctctacactttggaagacggatttgtc
attcggaacaaagctagggaaaatcctgaaaacccttctattgaactgggaccagaattt
aagaaggttagcaacttcttgggccgcttcaagtcaattcctagtatcgttgagcttgac
agtctaaaagtggctggtgatgtatggtttggagctggtgttatcctcaaggggaaagtc
agcattgtatcaaagcccggtgtaaagctggaagttcccgacggtgttgccattgtagac
aaggaaattaatggcccagaggacctgtga

DBGET integrated database retrieval system