KEGG   Glycine max (soybean): 100790223Help
Entry
100790223         CDS       T01710                                 

Definition
protein disulfide isomerase-like 1-4-like
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
gmx  Glycine max (soybean)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100790223
Enzymes [BR:gmx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100790223
Exosome [BR:gmx04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100790223
  Exosomal proteins of colorectal cancer cells
   100790223
  Exosomal proteins of bladder cancer cells
   100790223
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 586 aa AA seqDB search
MLTRKRLVVSLSLATLLLFSSLSLSLCDKTPPQNDNKKNNNDDDEDLSFLEESDDAATTS
HQGHFPDPDEFDEDDGDDEDDFGDFAGFDHSSEEAFKEPEVDDKDVVVLKERNFTTVVEN
NRFVMVEFYAPWCGHCQALAPEYAAAATELKPDGVVLAKVDATVENELANEYDVQGFPTV
FFFVDGVHKPYTGQRTKDAIVTWIKKKIGPGVSNITTVEEAERVLTAGSKVVLGFLNSLV
GAESDELAAASKLEDDVNFYQTVVADVAKLFHIDASVKRPALILLKKEEEKLNHFDGQFV
KAEIADFVTSNKLPLVTTFTRESAPVIFESQIKKQLLLFVTSNDTEKFVPVFKEAAKIFK
GKLIFVHVESDNEDVGKPVADYFGIAGNGPKVLAFTGNDDGRKFLLDGEVTIDTITAFGN
DFLEDKLKPFLKSDPVPESNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQALEP
TYNKLAKHLRSIESIVIAKMDGTTNEHPRAKSDGFPTLLFFPAGNKSSDPIPVDVDRTVK
DFYKFLRKHASIPFQLQKLASTTKTASESSDVKESQSSTTEVKDEL
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgctaactcgtaaacgactcgtcgtttctctctctctcgccactctccttctcttctca
tccctctctctctctctctgcgataaaaccccccctcaaaacgacaacaaaaaaaacaac
aacgacgacgacgaagatctcagcttcctcgaggaatccgatgacgctgccaccacttct
caccaaggccattttccagatcccgacgagttcgacgaggacgacggcgacgacgaggac
gacttcggcgacttcgctggcttcgaccactcgtcggaggaggcgttcaaggagcccgag
gtggacgacaaggacgtcgtcgttttgaaggagcgcaacttcaccaccgtcgtcgagaac
aaccgcttcgtcatggtcgagttctacgcgccctggtgcggccactgccaggccctcgcg
ccggagtacgccgccgccgccaccgagctcaagcccgacggcgtcgttctcgccaaggtc
gacgccaccgtcgaaaacgaattggcgaacgagtacgacgttcagggtttccccaccgtc
ttcttcttcgtcgatggggtccacaagccctacactggccaaagaaccaaagacgctata
gtgacatggattaagaagaagataggacctggtgtgtccaacattactacggtggaagaa
gctgaacgtgtattgaccgcgggaagcaaagttgttttgggcttccttaactctttggtt
ggtgcagagagtgacgaactggctgcagcatcaaagcttgaggatgatgtcaatttttat
caaactgtggtagctgatgtggcgaagcttttccatattgatgcaagtgttaaacgccct
gctttgatcttgctcaagaaagaggaggagaaattgaaccattttgatggccaatttgta
aaagctgaaatagctgattttgtaacctccaacaagcttcctttggttacaacttttact
agagaaagtgccccggtaatctttgaaagtcaaatcaagaaacaattgttgctgtttgtg
acttcaaatgatacagagaagtttgttccagtatttaaagaagcagcaaaaattttcaag
gggaagctgatctttgttcatgtggaatcggataatgaagatgtaggaaagcctgttgca
gattattttggtatcgcagggaatggtcccaaagtacttgcattcacaggaaatgatgat
ggaagaaaatttttgcttgatggagaggtgactattgacacaattacggcgtttgggaat
gatttccttgaagacaagctaaaacctttcctcaagtcagatccagttcctgaaagcaat
gatggtgatgtgaaaatagttgttggtaataactttgatgaaattgtcttggatgagtca
aaggatgttctgcttgagatttatgctccctggtgtggccactgccaagctctggaacca
acatacaacaagcttgctaaacatcttcgcagcattgagtctattgttatagccaagatg
gacggaacaacaaatgagcatcccagggccaaatctgatggattccccactcttctcttc
ttcccagcaggaaacaagagttctgaccctattcctgttgatgtggaccgtacagtgaaa
gacttttataagttcctcaggaaacatgcatcaatcccattccagctccagaaactagcc
tcaactactaaaaccgccagtgagagttctgatgtcaaggagagccaaagcagcaccacc
gaagtgaaggatgaattatga

DBGET integrated database retrieval system