KEGG   Glycine max (soybean): 100790223Help
Entry
100790223         CDS       T01710                                 

Definition
protein disulfide isomerase-like 1-4-like
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
gmx  Glycine max (soybean)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:gmx04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 586 aa AA seqDB search
MLTRKRLVVSLSLATLLLFSSLSLSLCDKTPPQNDNKKNNNDDDEDLSFLEESDDAATTS
HQGHFPDPDEFDEDDGDDEDDFGDFAGFDHSSEEAFKEPEVDDKDVVVLKERNFTTVVEN
NRFVMVEFYAPWCGHCQALAPEYAAAATELKPDGVVLAKVDATVENELANEYDVQGFPTV
FFFVDGVHKPYTGQRTKDAIVTWIKKKIGPGVSNITTVEEAERVLTAGSKVVLGFLNSLV
GAESDELAAASKLEDDVNFYQTVVADVAKLFHIDASVKRPALILLKKEEEKLNHFDGQFV
KAEIADFVTSNKLPLVTTFTRESAPVIFESQIKKQLLLFVTSNDTEKFVPVFKEAAKIFK
GKLIFVHVESDNEDVGKPVADYFGIAGNGPKVLAFTGNDDGRKFLLDGEVTIDTITAFGN
DFLEDKLKPFLKSDPVPESNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQALEP
TYNKLAKHLRSIESIVIAKMDGTTNEHPRAKSDGFPTLLFFPAGNKSSDPIPVDVDRTVK
DFYKFLRKHASIPFQLQKLASTTKTASESSDVKESQSSTTEVKDEL
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgctaactcgtaaacgactcgtcgtttctctctctctcgccactctccttctcttctca
tccctctctctctctctctgcgataaaaccccccctcaaaacgacaacaaaaaaaacaac
aacgacgacgacgaagatctcagcttcctcgaggaatccgatgacgctgccaccacttct
caccaaggccattttccagatcccgacgagttcgacgaggacgacggcgacgacgaggac
gacttcggcgacttcgctggcttcgaccactcgtcggaggaggcgttcaaggagcccgag
gtggacgacaaggacgtcgtcgttttgaaggagcgcaacttcaccaccgtcgtcgagaac
aaccgcttcgtcatggtcgagttctacgcgccctggtgcggccactgccaggccctcgcg
ccggagtacgccgccgccgccaccgagctcaagcccgacggcgtcgttctcgccaaggtc
gacgccaccgtcgaaaacgaattggcgaacgagtacgacgttcagggtttccccaccgtc
ttcttcttcgtcgatggggtccacaagccctacactggccaaagaaccaaagacgctata
gtgacatggattaagaagaagataggacctggtgtgtccaacattactacggtggaagaa
gctgaacgtgtattgaccgcgggaagcaaagttgttttgggcttccttaactctttggtt
ggtgcagagagtgacgaactggctgcagcatcaaagcttgaggatgatgtcaatttttat
caaactgtggtagctgatgtggcgaagcttttccatattgatgcaagtgttaaacgccct
gctttgatcttgctcaagaaagaggaggagaaattgaaccattttgatggccaatttgta
aaagctgaaatagctgattttgtaacctccaacaagcttcctttggttacaacttttact
agagaaagtgccccggtaatctttgaaagtcaaatcaagaaacaattgttgctgtttgtg
acttcaaatgatacagagaagtttgttccagtatttaaagaagcagcaaaaattttcaag
gggaagctgatctttgttcatgtggaatcggataatgaagatgtaggaaagcctgttgca
gattattttggtatcgcagggaatggtcccaaagtacttgcattcacaggaaatgatgat
ggaagaaaatttttgcttgatggagaggtgactattgacacaattacggcgtttgggaat
gatttccttgaagacaagctaaaacctttcctcaagtcagatccagttcctgaaagcaat
gatggtgatgtgaaaatagttgttggtaataactttgatgaaattgtcttggatgagtca
aaggatgttctgcttgagatttatgctccctggtgtggccactgccaagctctggaacca
acatacaacaagcttgctaaacatcttcgcagcattgagtctattgttatagccaagatg
gacggaacaacaaatgagcatcccagggccaaatctgatggattccccactcttctcttc
ttcccagcaggaaacaagagttctgaccctattcctgttgatgtggaccgtacagtgaaa
gacttttataagttcctcaggaaacatgcatcaatcccattccagctccagaaactagcc
tcaactactaaaaccgccagtgagagttctgatgtcaaggagagccaaagcagcaccacc
gaagtgaaggatgaattatga

DBGET integrated database retrieval system