KEGG   Glycine max (soybean): 100790607Help
Entry
100790607         CDS       T01710                                 

Gene name
DXR1
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic-like
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
gmx  Glycine max (soybean)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    100790607 (DXR1)
Enzymes [BR:gmx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     100790607 (DXR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 474 aa AA seqDB search
MALNISSPAEVKSIFFADSFKSNCLTAKFSGGFAFKRKERRAASGGRVYCSVQATPPPPA
WPGRAVPEQGRKTWDGPKPISIVGSTGSIGTQTLDIVAENPDKFKVVALAAGSNVTLLAD
QVKRFKPQLVAVRNESLIAELEEALHDVEEKPEIIPGEQGIIEVARHPDAVSVVTGIVGC
AGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAQKHNVKILPADSEHSAIFQCIQGLP
EGALRRVILTASGGAFRDWPVDKLKDVKVADALKHPNWNMGKKITVDSATLFNKGLEVIE
AHYLFGADYDHIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTLSWPDRIYCSE
VTWPRLDLCKLGSLTFKTPDNVKYPSMNLAFSAGRAGGTMTGVLSAANEKAVEMFIDEKI
SYLDIFKVVELTCEKHQNELVSSPSLEEIIHYDLWARKYAASLQDSSSFTPILA
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggctctcaatatctcttctcctgctgaagtcaagtccatttttttcgctgattccttc
aagtctaactgcctcacagcaaaattctcaggtgggtttgcttttaagagaaaagagcgt
agagcagcatctggaggacgggtttattgctcagtgcaggcaacaccaccaccaccagcc
tggccgggacgagcggttccggaacaaggtcgcaagacttgggatggaccaaaacccatt
tcaattgtggggagtactggttcaattggaactcagacactagatattgtggcagagaat
ccagataagtttaaagttgtggcacttgcagctggttcaaatgttactcttcttgcagac
caggtaaaaagatttaagcctcaacttgttgctgttagaaatgagtccctaattgctgaa
cttgaagaggccttgcatgatgttgaagaaaaacctgagatcatccctggagagcaggga
atcattgaggttgctcgtcacccagatgcagttagtgtagtcacaggaatagtaggctgt
gcaggactgaagccaacagttgcagcgatagaagcagggaaagacatagctttggccaac
aaagagacattgattgctggaggtccttttgttcttcctcttgctcagaagcataatgta
aaaatacttccagctgattcagaacattctgccatctttcagtgtatccaggggttgcca
gagggtgcacttaggagagttattttaactgcatctggaggtgctttcagggattggcca
gttgataaactgaaagatgttaaagttgctgatgcattaaaacatcctaactggaatatg
gggaaaaagataactgtggactctgctaccctttttaataagggtctagaagtaattgaa
gcacattacttgtttggagctgactacgatcatattgagattgtcattcatccacaatca
atcatacattcaatgattgaaacacaggattcatctgttcttgcacaattggggtggcct
gatatgcgtttgccaatcctctatacattatcatggcctgacaggatttattgttctgaa
gtcacttggccacgccttgatctttgcaagcttggttcacttacatttaaaactccagat
aatgtaaagtatccatccatgaatcttgcattttctgctggccgtgctggaggcacaatg
acaggagttcttagtgcagcaaatgaaaaagctgtagagatgtttattgatgaaaagatt
agctatttggatatattcaaagttgtggagctaacatgtgagaagcatcaaaatgaattg
gtatcctctccttcccttgaggaaattattcactatgacctgtgggcgcgaaaatatgct
gctagtctgcaagactcttccagcttcactcctattcttgcatga

DBGET integrated database retrieval system