KEGG   Glycine max (soybean): 100791778Help
Entry
100791778         CDS       T01710                                 

Definition
(RefSeq) protein disulfide-isomerase 5-2
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
gmx  Glycine max (soybean)
Pathway
gmx04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100791778
Enzymes [BR:gmx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100791778
Chaperones and folding catalysts [BR:gmx03110]
 Protein folding catalysts
  Protein disulfide isomerase
   100791778
Membrane trafficking [BR:gmx04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    100791778
Exosome [BR:gmx04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100791778
  Exosomal proteins of colorectal cancer cells
   100791778
  Exosomal proteins of bladder cancer cells
   100791778
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 Thioredoxin_8 Thioredoxin_7 Calsequestrin AhpC-TSA TrkA_N OST3_OST6 T2SSS_2
Motif
Other DBs
NCBI-GeneID: 100791778
NCBI-ProteinID: XP_003536390
UniProt: I1LD87
Position
10
AA seq 433 aa AA seqDB search
MRMKRVFVVYSVLLLLVQFWLGEAETFSVDGKVLVLDESNFDSAIASFDHILVDFYAPWC
GHCKRLSPELDAAAPVLATLKEPIIIAKVDADKHTRLAKKYDVDAYPTILLFNHGVPTEY
RGPRKADLLVRYLKKFSASDVSILDSDSAVNMFVEEAGTFFPIYIGFGLNSSVLEKFGIK
YKKNAWFSVAKDFSEDLMVLHDFDKIPALVSLNPQYNERNTFYGPFEEDFLEDFVRQNLI
PLAVPVSYETLKLMKADGRKIVLTIVEDEDEETTRELIKLLKAAASANRDLIFGYVGVKQ
MEEFAENFDIDTKLPKMVIWDKSDDYLSVVDSETIEGEDQGTQITKFLEGYREGRTIKKT
FSGPSLMRFIHRSFDIRMVYIIVFVVAVLMLIQTFSKGGDEYQSVPNQVQTDHAISSVSE
AENNEYKPGDKED
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaggatgaagagggttttcgttgtttacagtgttttgttgctgctggtccagttttgg
cttggtgaggctgagacattctcggtggatggaaaggttttggttttggacgaatccaac
ttcgattccgccatagcctccttcgatcacatcttggttgacttttacgctccctggtgt
ggccactgcaagcgtctctctcccgagttagatgcagccgcccctgtacttgcaaccttg
aaggaacccataatcatagcaaaagtagatgcagacaagcatacccgccttgcgaaaaaa
tatgatgttgatgcatatccgaccattttgctgtttaatcatggcgtccccacagaatac
cgtggaccaaggaaggcagatttacttgttcgttatctgaagaaattttctgcttctgat
gtttccattctggattcagattctgctgtgaatatgttcgttgaagaagcaggcactttt
ttcccgatttatataggttttggtttgaacagttcggtactagaaaagtttggcataaag
tacaagaaaaatgcatggttttctgtggcaaaggatttttcagaggatctcatggtattg
catgactttgataagattcctgccttggtttccctgaatccacagtacaatgagcggaac
acattctatggaccctttgaagaggattttttagaagattttgtaagacaaaacctgatt
cctttggctgtgcctgtatcctatgaaacactcaagttgatgaaagcagatggaaggaaa
atagttttgacaattgttgaggatgaagatgaagaaacaacaagagagctgattaagtta
ttgaaggctgcggcatctgcaaatcgtgacttaatatttggttacgttggagttaaacag
atggaagaatttgctgaaaattttgatattgatactaaactaccaaaaatggtcatttgg
gataaaagtgatgattacctttcagttgttgattcagaaaccatagagggggaggaccaa
ggaactcaaatcactaaatttctcgaaggatacagggaaggaagaaccataaagaaaaca
tttagtggcccttcactaatgcgattcatccatcgatcctttgacattagaatggtgtac
atcattgtttttgtggtggcagtactgatgctaattcagacattcagtaaaggaggtgat
gaataccagagtgtacccaatcaagttcaaactgatcatgcaatcagttctgtttctgaa
gctgaaaacaatgagtataaacctggtgacaaggaagactaa

DBGET integrated database retrieval system