KEGG   Glycine max (soybean): 100792437Help
Entry
100792437         CDS       T01710                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 17-like
Organism
gmx  Glycine max (soybean)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 927 aa AA seqDB search
MLVPGILGFPGLVYLVLALGFAVIRHVWRNAEAKREEEAVMMMRLVADADVTEMEVAEEA
VAVASEVEYSSLAPVNGSRWYQCAMCCAPTTMRCSRCKAVRYCSGKCQISHWRQGHKDEC
CPPTTTMELKDENLSSRASVSKTESGLHEINGTHAGISSSNDSYSSLDPLVAARKSFDDN
HRSRFAKPVCNDTTDDTSVASPHNKQTVNMKCSENIEVKDSSASKRSKSNHSNATDETRF
KSKFPKTQSDTSHDEAANLGSHERRRKAAIVEKLAKDTSKCKTVPYLSGSSKYVVIDDVE
EESHLPKYREARRSSSSSRERLSSATKGDFPSQSKCMETDNCHTLPAKVSAVPNLPQNVC
SGLKISMQKVVQQFRSSKESRSNSISAENEMGFPYELFVELYCYDKMKLFPFGLTNCGNS
CYANAVLQCLAYTRPLTSYLFQGFHSKRCQKKGWCFTCEFEYLIQKAKEGISPLSPIGIL
SKIHKIGSHLGRGKEEDAHEFLRCAVDTMQSVCLKEVGVSSPLAEETTLVGYTFGGYLRS
KIKCLRCLGKSERYERMMDLTVEIDGDIGTLEEALGQFTAPEILDKDNKYNCSRCKTYEK
ARKKLTVLEAPNILTIVLKRFQSGNFEKLNKSVQFPEVLNMAPYMSGTKDKSPLYSLYAV
VVHLDIMNAAFSGHYVCYVKNIQGEWFRTDDSRVEPVELSRVLSERAYMLLYARHSPKPL
GLVSSNVISSAGKFKRRNLEAIPASSKTRSNSMATSGESPSLQQKHGKYPNWNDGDDSLR
NDFAYPEEWRFQYGGTNTMVDSSSESSLFSSSDASSCSTASIKDSASSADFSDYIFGEVG
PSWYSHYGLSSNMGASSSHDNLDTDFLVDSSGASRRRRQDSEDKAVLYANKNKNRSGSRG
VDLKRYITANHYDKNSGVHVRRISGDA
NT seq 2784 nt NT seq  +upstreamnt  +downstreamnt
atgctggtgcccgggattttagggtttccgggtctggtgtatctagtgttggcgttgggt
ttcgcggtgattcggcacgtgtggagaaatgcagaggccaagagggaggaggaggcggtg
atgatgatgaggttggtggcagatgctgacgtgacggagatggaggttgctgaggaggcg
gtggcggtggcgtcggaggtggagtattcttctctggctccggtgaatggttctcggtgg
taccaatgtgcgatgtgttgtgcacccactaccatgcgatgttctcgctgcaaggccgtc
agatattgttcgggtaagtgtcaaattagtcactggagacaaggtcacaaggacgaatgt
tgtcctccaactaccaccatggagctcaaagatgaaaatctttctagcagggcatcggtg
tccaaaacagagtctggtcttcatgaaattaatggaacacatgctggtatttcatcttcc
aatgattcgtattccagccttgatcctttggttgctgcaagaaaatcttttgatgataac
catcgcagcagatttgcaaaacctgtctgcaatgatactactgatgatacaagtgttgct
tcccctcataacaaacaaacagttaacatgaaatgttctgagaatattgaagttaaggat
tcaagtgcaagtaaaagaagcaagtcaaatcatagtaacgctactgatgagactcgattt
aaatcaaaatttcccaaaactcaatctgacacatctcatgatgaggcagcaaatttgggt
agccatgaacgcagaagaaaagctgcaatagttgaaaaattagcaaaagatacttctaaa
tgcaaaactgtgccttacttgagtggttcaagtaagtatgttgtaattgatgatgtagaa
gaagaatctcatttgcccaaatacagagaagcacgaagatcatcatctagttctcgtgaa
cgactatcctcagctactaagggggattttccttcacagtccaagtgtatggaaactgac
aattgtcataccttacccgcaaaagttagtgctgttccaaatctgcctcaaaatgtttgt
agtggtctgaaaatatcaatgcagaaagttgtccagcagtttagaagctcaaaagagtca
agatccaattcaatatctgctgaaaatgagatgggctttccttatgaactctttgtggaa
ctttactgttatgacaagatgaagctattcccctttggccttacaaattgtgggaacagc
tgttacgctaatgcagttctccagtgcttagcatatactcggcctctgacttcatatctt
tttcaaggattccattcaaaacgatgtcagaagaagggatggtgttttacatgtgagttt
gaatatctaattcagaaggcaaaagaagggatttctccactttcaccaattgggatatta
tctaagatacacaagattggaagccatcttgggcgtgggaaggaagaagacgctcatgaa
tttttgaggtgcgcggttgatacaatgcaatctgtttgtctcaaggaagttggtgtttca
agtcctttggcagaagaaacaactctagttggttacacctttggaggttatttacgatct
aagataaagtgcttaagatgcctggggaaatctgagaggtacgagagaatgatggatctt
actgttgaaattgatggggatattggaactttggaggaggctcttggacaatttacagca
cctgaaatcttggataaagataacaagtataactgcagcagatgtaaaacatacgagaaa
gccaggaagaagttgacagtgttggaggcaccaaatattcttacaattgtattaaaacga
tttcagtctggtaacttcgagaagttgaataagtcggttcagttccctgaggtcctgaat
atggctccatatatgagtggaacaaaagataaatctccattatacagcctttatgcagtg
gttgtccatttggatatcatgaatgctgcattttcaggccattatgtctgttatgtgaag
aacatccaaggagaatggttcaggactgatgacagcagggtagaacctgttgaattgtcg
agagtcttatcagaaagggcatacatgcttctttatgcaaggcactctccaaagccactg
ggtttagtaagtagcaatgtaatatcttctgctggaaagttcaagaggaggaacctggaa
gccattcctgcttcttctaagacaagatcaaattccatggctacaagcggcgagtctccc
tccctacagcagaagcatggcaagtaccctaactggaatgatggcgatgattccttaaga
aatgattttgcatatccagaagaatggagattccagtatgggggaacaaatacaatggtg
gattcttctagtgaaagttcacttttcagctcttcagatgcaagttcttgcagtactgca
agtatcaaggactcagccagttctgctgatttctcggattacatatttggtgaggtggga
cccagttggtatagccactatgggctttcatctaacatgggggcttcttcctcccatgat
aacttggatacagatttcttagttgatagtagtggtgcaagtagaaggcgccggcaggac
tcagaagataaagcagttttgtatgctaacaaaaacaaaaatcgtagtggcagtagggga
gttgaccttaaaagatatatcactgctaaccattatgacaaaaattctggtgtacatgtg
agaagaataagtggagatgcataa

DBGET integrated database retrieval system