KEGG   Glycine max (soybean): 100792499Help
Entry
100792499         CDS       T01710                                 

Definition
1,4-alpha-glucan-branching enzyme-like
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
gmx  Glycine max (soybean)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100792499
Enzymes [BR:gmx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     100792499
Exosome [BR:gmx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100792499
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 898 aa AA seqDB search
MINCLGLYPLISAPSTIACTTHIVRSKQYLATQKPVNLALGYRNPHGYGFSFGSRRSIHE
RVSSHFKGIAVMTDDKSTMSSTEEDLENIGIFHIDPSLKPYKDHFKYRLKRYVDQKKLIE
EYEGGLEEFSQGYLKFGFNREEGGIVYCEWAPAAQEAQIIGDFNGWDGSNHQMEKNQFGV
WSIRIPDTDGNSAIPHNSRVKFRFRHGDGVWVDRIPAWIKYATVDPTRFAAPYDGVYWDP
PLSERYQFKYPRPPKPKAPRIYEAHVGMSSFEPRINSYREFADEILPRIRANNYNTVQLM
AVMEHSYYASFGYHVTNFFAVSSRSGTPEDLKYLIDKAHSLGLQVLMDVIHSHASNNVTD
GLNGFDVGQTSQDSYFHTGDRGYHKLWDSRLFNYANWEVLRFLLSNLRWWLEEFKFDGFR
FDGVTSMLYHHHGINIAFTGDYNEYFSEATDVDAVVYLMLANCLIHSILPDATVIAEDVS
GMPGLGQPVSDGGIGFDYRLAMAIPDKWIDYLKNKNDYAWSMKEISWSLTNRRYTEKCVS
YAESHDQAIVGDKTVAFLLMDEEMYSGMSSLVDASPIVERGIALQKMIHFITMALGGEGY
LNFMGNEFGHPEWIDFPREGNGWSYEKCRRQWNLVDTDHLRYKFMNAFDRAMNLLDDKFS
FLASTKQIVSSADDDDKVIVFERGDLIFVFNFHPENTYEGYKVGCDLPGKYRVALDSDAW
EFGGRGRVGHDVDHFTSPEGIPGVPETNFNNRPNSFKVLSPARTCVAYYRVEESQEDDDN
NSLVGVEETSAAADVAKIPDESASTESEDIKLDGVKETLAAADVAKIPDESAPLESEDSN
LDVVKEPLAAANAEVTKISGELVSVETEGINLDKLEETIVAASVESEVVRDKPEDAAN
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atgattaactgtttgggcctttatcctcttatttctgccccttcaaccattgcctgcacc
actcacattgtgagaagtaagcagtatcttgcgacacaaaagccagtaaatctggctctc
ggctatcggaatccacatggatatgggttcagttttggatcgagaagatcaatacacgag
agggtgagctctcatttcaagggcatagctgttatgacagatgacaaatcaacaatgtca
tccaccgaggaagacttagaaaacattggcatctttcatattgatccatccctaaagcca
tataaagatcacttcaaatatagactgaagagatatgtagatcagaaaaagcttattgaa
gaatatgaaggaggtcttgaagaattttctcaaggttatttgaaatttggatttaacaga
gaagaaggtggtattgtttactgtgagtgggcacctgctgcacaggaagcacaaattatt
ggagactttaatggatgggatggttccaaccaccagatggaaaaaaatcagtttggtgtt
tggagtattaggatccctgatactgatggaaattctgccataccacacaattcaagagtg
aagtttagatttagacacggggatggagtttgggttgatcgcatccctgcttggatcaaa
tatgccactgttgatcctaccagatttgccgcaccatatgatggtgtctactgggatcca
ccactttcagagaggtatcagtttaaatatcctcgtccaccaaagccaaaggccccgcgg
atatatgaggctcatgtggggatgagtagctttgaaccccgcataaactcttacagggaa
tttgcagatgagattttgccccgtattcgggcaaataactataatacagtccagctgatg
gctgtgatggagcattcttattatgcatcatttggatatcatgtaacaaattttttcgct
gtgagcagtagatctggaacccctgaagatcttaaatatctgatagataaggcccatagc
ctaggtttgcaggttttgatggatgttatccatagtcatgctagtaataatgttactgat
ggactcaatggctttgatgttggccaaacctcacaagattcttacttccatactggagat
agaggctatcataaattgtgggacagtagactcttcaactatgctaactgggaagttctt
cgtttccttttatcaaatttaaggtggtggcttgaagagtttaaatttgatggatttcga
tttgatggagtaacatcaatgctgtatcatcaccatggaatcaacattgcatttacaggg
gattataatgaatattttagtgaagcaacagatgtggatgctgttgtctatctgatgctg
gctaattgtctgatccatagtattttgccagatgcaactgtcattgctgaagatgtttct
ggcatgcctggacttggtcaaccagtttctgatggtggaattggttttgactatcgtcta
gccatggcaatccctgataaatggattgattacttgaagaacaagaacgactatgcatgg
tcaatgaaggaaatctcttggagtttgacaaataggagatacactgagaaatgtgtttcc
tatgctgaaagccatgatcaggccattgttggagacaagactgttgcatttctcctaatg
gatgaagaaatgtattctggcatgtctagcttggttgatgcttctcctattgttgagaga
gggattgctcttcagaagatgatacacttcataacaatggcattaggtggagagggctac
cttaatttcatgggcaatgagtttggccatccagagtggattgatttcccaagagaaggc
aatggatggagttatgagaagtgcaggcgtcagtggaatctggtggatacagatcacttg
agatataagttcatgaatgcatttgacagagcaatgaacttgcttgatgataaattctca
ttccttgcatcaacaaaacagattgtgagcagtgcagatgatgatgacaaggttatagtc
tttgagcgaggagatctgatatttgtattcaattttcatccagagaatacatatgaaggg
tataaagttggatgtgacttacctggaaagtatagagttgcattggatagtgatgcttgg
gaatttggaggacgtggaagagtggggcatgatgtagaccacttcacatccccagaaggc
ataccaggagtccctgaaacaaattttaataatcgccccaattcattcaaggtcctctcc
cctgctcgtacttgtgtggcatattatagagtggaagaaagtcaagaagacgacgataat
aacagtttggttggggtagaagagacttctgctgcagcagatgttgcaaaaattcctgat
gaatccgcttctacagaaagtgaagatatcaaattggatggggtgaaagagacattagct
gcagcagatgttgcaaaaattcctgatgaatctgcccctttagaaagtgaagatagcaat
ttggatgtggtgaaagagccgttagctgcagcaaatgctgaagttacaaaaatttctggt
gaattggtttctgtagaaactgaaggtatcaatttggataagttggaagagacaatagta
gcagcttctgttgaaagtgaggtagttcgagacaaaccagaagatgcagccaactga

  All links  
No link information was found.   
DBGET integrated database retrieval system