KEGG   Glycine max (soybean): 100792777Help
Entry
100792777         CDS       T01710                                 

Definition
serine/threonine-protein kinase ppk15-like
Orthology
K18670  
dual specificity protein kinase YAK1 [EC:2.7.12.1]
Organism
gmx  Glycine max (soybean)
Brite
Enzymes [BR:gmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100792777
Protein kinases [BR:gmx01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   100792777
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
16
AA seq 951 aa AA seqDB search
MDGVARAVEQAQSSSGLASGWRPRGSVFSPCKPKGEEEASAAAGKKPQQPLHVVVRKPLV
ARLTKEIVETYQICNPQFKYSEDLNPKRFLTSPSVGVLNDGYDNVNSDLILTVNFVLIHL
EKNKRYIVKDLLGHGTFGQVAKCWDSDTNSFVAVKIIKNQPAYYQQALVEVTILTTLNKK
YDPEDKHHIVRIYDYFVYQRHLCICFELLDTNLYELIKMNHFRGLSLGIVQLFSKQILYG
LALLKEAGIIHCDLKPENILLCTSTVKPAEIKIIDFGSACMENRTVYSYIQSRYYRSPEV
LLGYQYTTAIDMWSFGCIVAELFLGLPLFPGASEFDLLKRMIEILGGQPPDYVLRDAKNT
SKFFKCIGSLQNIESSESSKNGRSVYQTLTVEEYEARELKKPSIGKEYFNQLNLEAIVTN
YPYRKNLPKEDILKESQIRLALIDFLKGLVEFDPAKRWSPFQASKHPFVTGEPFTHPYKP
PPETPHMPVVQNIKVDNHPGGGHWFAAGLSPNVSGKSRASLYSSPHFQMVQHPPANSYGS
VGSHGSYNDSVGLGSSYGSYGESSNMFAYYSPIGPSGMNMHNQGSMSMLGNSPDARRRVK
YQPGNGLGISPSAGNFAPLPLGASPSQFTPPSSYSQVSVSSPGHYGPTSPARGTSHGSPL
GKTAAVSQFNRRKNWGHSGSPQTQETFSSHWPGQYPDSTSHTEGTSQALGSSPSYLQSNS
NPGNWKQRGSGGLSANQNISSLMKPSASMNPQSTEVVHDNAETGISLPDPGDWDPNYSDE
LLLQEDGSDESSLTTEFGRSMNLGSTETWAGFGRFNHVSSTSTPIIMQRLNAPSQAFTNV
EMGSLPTHDLQTTYVPSMSKHFHLMPHILQNSPSRFGHQSVQRFTHGRPPQGAEWNQIKI
QATSSGFSSVGPRSPRNNSFTNSMTWGRRMNPPVSSMPPTSRARKDYARID
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atggatggggtcgcacgtgcggtggagcaggctcagtcatcatcgggcttggcctcgggg
tggcgtccccgcggctccgtgttctctccttgtaagcctaagggcgaagaagaagcttct
gctgctgctgggaagaagccgcagcaaccgttgcacgtggttgtgaggaaacctttggtg
gctagattgaccaaggaaatagttgaaacataccaaatatgcaatccacagtttaaatat
tctgaagatctaaatccaaaaagatttttgaccagcccgtctgttggagtgcttaatgat
ggctatgataatgtaaactcggatctgattttgacagtgaattttgtcttgatccattta
gagaaaaataaaagatatattgtcaaagatctccttggccacgggacatttggacaagtg
gctaaatgctgggattcagataccaacagttttgttgctgtgaagatcattaaaaatcaa
cctgcatactatcaacaggcgctggttgaagtaactattttaacaacgttaaataagaag
tatgatcctgaggataagcatcacattgttcgtatatatgattattttgtatatcaacga
catttgtgcatttgctttgaattgctggacacaaacttgtatgagcttatcaagatgaat
cattttaggggattatcacttggtattgttcagctattctctaagcagattttatatgga
ctggctctactaaaagaggctggcattattcattgtgatctgaagccagaaaacattctt
ttatgtacgagcactgtgaagccagcagaaataaaaatcattgactttggatcagcatgc
atggaaaaccgcaccgtttactcttatattcagagtcgatactataggtcacctgaggtt
cttcttggatatcaatacacaacagctattgatatgtggtcctttgggtgcatagtggcg
gaattgtttcttggattaccattattccccggggcttcagaatttgatcttttgaaaagg
atgattgaaatacttggtggacaaccacctgattatgtactaagggatgccaaaaacaca
agtaagttcttcaagtgtattgggagtctccagaacattgagagcagtgagagttctaaa
aatggaagaagtgtttatcaaacattgacagtggaagaatatgaagctagagaattgaag
aagccatcaattggaaaagagtattttaatcagttgaaccttgaagcaattgttacaaat
tatccctacagaaaaaacctacctaaagaagatattctcaaagaaagtcaaatacgactg
gctcttatagattttctgaaagggcttgttgaatttgatcctgcaaaacgctggtcaccc
tttcaggcttcaaaacacccttttgtaactggggaaccttttacacacccttacaagcct
cctcctgagactcctcatatgccagtagttcaaaatatcaaggtggataatcatccagga
ggaggacactggtttgccgctggtctatcacctaatgtttcaggcaaaagcagagcttcc
ctttatagcagtccacattttcagatggttcaacatccgcctgccaatagttatggcagt
gtaggaagtcatgggagctataatgatagtgttgggcttggaagcagctatggaagttac
ggagagagcagtaacatgtttgcttactattcacctattggtccatctggtatgaacatg
cacaatcagggaagtatgtcaatgcttgggaatagtccggatgcaaggaggagagttaag
taccaacctgggaatgggctggggataagtccgtcagctggaaattttgctcccctgccc
cttggtgccagcccatctcaatttactccaccaagttcctatagtcaggtttcagtcagt
tctccaggacactatggacctacatctcctgcaagaggaacttctcacggatcaccttta
ggcaagacagctgcagttagccagtttaatagaagaaaaaattggggacattctggaagt
cctcaaactcaagaaacattttcttcacattggccaggtcaatatcctgacagcacaagc
catactgagggaacatcacaagctcttggcagttcaccatcatacctacagtcaaatagt
aatcctggaaactggaagcagcgaggaagtggagggttatctgctaatcagaacatttca
tccttaatgaagcccagtgctagtatgaacccacaatcaacagaagtggttcatgacaat
gcggagacaggcatttctttgcctgatcctggtgattgggaccctaattatagtgatgaa
ttacttcttcaagaggatggttcagatgaaagcagtttgacaactgagtttggcagaagt
atgaatcttggttctactgaaacatgggctggatttggaaggttcaatcatgtttccagc
acaagcactccaataatcatgcaaagactaaatgcaccaagtcaagcatttactaatgtt
gagatgggtagccttccaactcatgatcttcaaacaacatatgtaccctctatgtctaag
cattttcatctcatgcctcatattttacaaaattctccaagccgttttggacaccaatct
gttcaaagattcacacatggtagacccccccagggtgccgagtggaatcaaattaagatt
caggctacttcttctggtttcagcagtgtgggccctcgttctcccaggaataactcattc
accaacagtatgacatgggggcgaagaatgaatcctcctgtctcaagcatgcctccaaca
tcccgcgcaagaaaagattatgcaaggatagactag

DBGET integrated database retrieval system