KEGG   Glycine max (soybean): 100793021Help
Entry
100793021         CDS       T01710                                 

Definition
4-alpha-glucanotransferase DPE2-like
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
gmx  Glycine max (soybean)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:gmx00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
19
AA seq 965 aa AA seqDB search
MVNPGLFSANKSTNSVKVSFRIPYFTQWGQSLLVCGSVPVLGSWNVKKGVLLSPVHQGAE
LIWGGSITVPKGFQCQYSYYVVDDNKNVLRWEMGKKRELVLREGIQSGQEIEFRDLWQTG
SDALPFRSAFKDVIFRQSWDLSDATVGVNHINVEPEGEAILVQFKISCPNIEKDTSIYVI
GSNTKLGQWKVENGLKLSYFGESVWKAECVMQRSDFPIKYRYGKYDRSGNFSIESGPNRE
VYANSPRNEAKYIFLSDGMMREIPWRGAGVAVPMFSVRSESDLGVGEFLDLKLLVDWAVA
SGFHLVQLLPINDTSVHGMWWDSYPYSSLSVFALHPLYLRVQALSKNIPEEIKKEIEKAK
QQLDGKDVDYEATMATKLSIAKKVFAQEKDLILNSSSFKEFFSENEGWLKPYAAFCFLRD
FFETSDRTQWGCFAHYSEDKLEKLVSKDSLHYEIICFHYYVQYHLHLQLSEAAEYARKKG
VILKGDLPIGVDRNSVDTWVYPNLFRMNTSTGAPPDYFDKNGQNWGFPTYNWEEMSKDNY
GWWRARLTQMAKYFTAYRIDHILGFFRIWELPDHAATGLVGKFRPSIPLSQEELEREGIW
DFNRLSYPYIKRELLQEKFGDAWTFVATTFLKEIDKNFYEFKEDCNTEKKIASKLKTCAE
SSLLLESVDKLQRNLFDLSQNIVLIRDPEDPRKFYPRFNLEDTISFQDLDDHSKNVLKRL
YHDYYFCRQENLWRQNALKTLPVLLNSSDMLACGEDLGLIPSCVHPVMQELGLVGLRIQR
MPNEPDLEFGIPSKYSYMTVCAPSCHDCSTLRAWWEEDEERRLRFFKNVMESDGLPPDQC
VPEVAHFVIRQHFEAPSMWAIFPLQDLLALKEEYTTRPATEETINDPTNPKHYWRFRVHV
TLESLIKDNDLQTTIKDLVSWSGRSLPKEDDSEIEASPVSVLSAAEALSEKQKFASTTEK
PVLVK
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atggtgaatccgggattgttttctgcgaataagtctacgaattcggtgaaagtaagcttt
cggataccgtatttcacccaatggggtcagagcttgctggtgtgtggctctgtaccagtt
cttggttcctggaatgtgaagaagggtgtgttgctcagccccgttcatcaaggggctgag
ctcatatggggtggaagtatcactgtgccaaaagggttccaatgccagtacagctattat
gttgtagatgataacaaaaatgtactgagatgggagatggggaagaagcgtgaactggta
ctccgtgaagggattcagagtggccaggagattgagttccgtgatctttggcagactggc
tcagatgcacttcctttcagaagtgctttcaaagatgtcatttttcggcaaagctgggac
ttgagcgatgcaaccgtaggagtaaaccacattaatgttgaaccggaaggagaagctatc
ttggtccaattcaaaatttcctgcccaaatattgagaaagacacatcaatatatgtcatt
ggcagcaatacaaagttggggcagtggaaagttgaaaatggactaaaactcagctatttt
ggtgaatctgtctggaaagctgaatgtgtgatgcaaaggagtgattttccaatcaaatat
agatatggaaaatatgacaggagtgggaacttttctatagagagtggtccaaatcgagaa
gtctatgctaactccccaaggaatgaggcgaaatatatttttctttcagatggcatgatg
cgggaaataccttggcgtggtgctggtgtagcagtccccatgttttctgttaggtcagaa
tctgatctgggtgttggggagtttcttgaccttaagttgctagttgactgggctgtagca
tctggtttccatttagttcaacttttaccaatcaatgatacatctgtgcatgggatgtgg
tgggattcttatccatacagttcactctcagtctttgcattgcatccattgtacctgaga
gtacaggcactttctaagaacatacccgaggagatcaagaaagagattgaaaaggcaaaa
cagcaattggatgggaaggatgttgattatgaggctacaatggctactaaactctcaatt
gctaagaaagttttcgctcaagagaaagatttgatacttaattcaagttcctttaaggag
ttcttttctgagaatgagggttggttgaaaccttatgctgctttctgtttcctgcgggac
ttctttgaaacatcagatcgcactcaatggggttgttttgctcattactcagaggataag
ctagagaaacttgtatccaaggacagcctgcattatgagataatttgcttccactactat
gttcaataccatttacatttacaattatcagaagctgcagaatatgcaagaaagaaggga
gtgatactaaagggagatcttcctattggagttgacagaaacagtgtggatacctgggtt
tatccaaatttgtttcgaatgaacacttctactggggcacctccagattattttgataaa
aatggccagaattggggtttccctacttataattgggaagaaatgtcaaaggacaactat
ggttggtggagagctcgattgacacagatggcaaaatattttacagcttacaggattgat
cacattttgggattcttccgaatttgggaacttccggatcatgctgcgacaggtcttgtt
ggaaaattccgaccatctattcctcttagtcaggaagaacttgaacgagaaggaatatgg
gactttaatcgcctaagttacccatatattaagcgggaactattacaggaaaaatttggt
gatgcttggacttttgttgcaacaacttttctaaaggaaattgacaagaacttctatgag
ttcaaggaggattgcaacacagagaaaaaaattgcttccaaactgaaaacttgtgcagaa
agttctctcttgttggagagtgtagacaaattgcagcgtaatctctttgatctttcacag
aatatagttctaatccgagatccagaggatccaagaaaattttatcctcgtttcaacctt
gaagataccataagtttccaggatttggatgatcatagcaagaatgttctcaaacgatta
taccatgactactatttctgtcgtcaagagaatctttggaggcaaaatgcattgaagacc
ctgcctgtacttctaaattcatcagacatgctggcctgtggggaagatttgggtctcatt
ccatcttgtgtccatcctgttatgcaagaactgggattagttgggttgcgcattcagcgc
atgcccaatgaacctgatctggaatttggtattccttctaagtacagctacatgacggta
tgtgccccttcatgtcatgactgttccaccttgcgtgcttggtgggaagaagatgaagaa
agaagactccggtttttcaagaatgtgatggagtccgatgggttgccgcccgatcaatgt
gttccagaagttgcacattttgttataaggcagcattttgaagccccatcaatgtgggca
atcttccctcttcaggacttgctagcattaaaagaagaatatacaacacgccctgcaaca
gaggagacaatcaatgaccctacgaatccgaagcactattggagattccgtgtgcatgtg
actttggaatcattgatcaaggataatgacctccaaaccaccatcaaagatctcgtcagt
tggagtggaagatcactccctaaggaagacgactcagaaatagaagcgagcccagtgtcg
gtgttgtcagcagcagaagctctttctgagaagcagaagtttgccagtaccacggaaaag
cctgttcttgtcaaataa

DBGET integrated database retrieval system