KEGG   Glycine max (soybean): 100793079Help
Entry
100793079         CDS       T01710                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 17-like
  KO
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.4.19.12]
Organism
gmx  Glycine max (soybean)
Brite
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100793079
Peptidases [BR:gmx01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100793079
Ubiquitin system [BR:gmx04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100793079
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
6
AA seq 1128 aa AA seqDB search
MRVTGDLGFSSLVLVVVCVVVAVIGFVIRHKWQVSEARKEEIKRLFILAAEETARAEKEA
SYEYGTAVSAAPTNLCAVCYFPATARCAQCKSVRYCSFECQTVHWRQGHKLECRPPSTTH
QSDGATSDLGSKVVEQGYSGIHVGKSESEGKECKIASERPPIFDICFSPKVSSGKDANIR
VESLAEGNITDSNSELSSNSFSGFSASTGSSDSSDGSSVCESIISNEHDGSEGHTFVDPT
LDIPDNTIDDSMGVTMSSSPKFATLVDSVDGFSTMRKLNHTGPGFSKEESKLASNGNSGS
SMWKGKTIEPSTVFSGFWDKALDSRGIKDDTKNDTYPSCSDESTGKKTASESSFHFPFST
MPPLHVRDTKTNDSVSDDAFPNCIGNNMASSGSASSENDNMNSSKGRNFSFINSKVSNVR
SYVTPSGSESDQLESKESSGPPLSSFSPQPSSVGKNSVCADALSFHNSQSTGSSNLVVAN
GGSTLKSTEIGCLTCELADSNLASVTEEHHSSTKQGNNDIESGTRAVTSSQVASCSANSK
SGLKTSVLKVVDQFRGSNLSKHFPLVVGSDLAGRRNDKSFFPYELFVKLYNSNKVELCPF
GLVNCGNSCYANAVLQCLAFTPPLTAYLLQGLHLKSCANKKWCFTCEFERLILKSKDTKS
AVSPMGIISHLQNIGSQLGNGREEDAHEFLRHVIDTMQSVCLTEAGVNASGSLEEDTTLM
GQTFGGYLRSKIKCMRCGGKSEHQERMMDLTVEIEGEITTLVEALRRFTSTETLDGENKY
HCVRCKSYEKAKKKLTVSEAPNVLTVALKRFQSGKFGKLNKPIQFPEILNLAPFMSGTSD
KSPIYRLYGVVVHLDVMNASFSGHYVCYVKNIQNKWSKVDDSVVSPSIYISIANTEVVNI
LAESPCRCSPRAPRLIRNRILSPDSKSKVSGKTLTTKARYISTNSGVSEHANSSISSDDS
PALASFYSKFHHLKRILEEDSSSDNSSLISSNSDEGSCSTDSTRDSTNTDDFSEYLFGDS
GNGWSSVWRNSDSDTSSSSSSSPLNWGHSPLSDVDRYDSVSPVAAGLRGIDVSRLSFNTT
LQHRKLDSSRINSNSSSRETDSFMKLGSNHFNDIDSGVLCRKPGKRTD
NT seq 3387 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtcaccggggatctagggttttcgagcctggtccttgtggtggtttgtgttgtg
gtggcggtgatcgggttcgttattcggcataaatggcaggtttcggaggccaggaaggag
gagatcaagaggcttttcattttggccgcggaggaaactgccagggccgagaaagaggcg
tcctatgagtacggcacggcggtttctgccgctccgaccaatctatgcgctgtgtgttat
tttcccgccaccgcgcgctgcgctcagtgcaaatccgttcgctactgttcttttgaatgc
caaactgttcattggcgtcaaggtcacaagttagaatgccgtcctcccagcacaactcac
cagagtgatggtgcaacgagtgatcttggcagcaaggtagtagagcaaggctattctgga
atccatgttgggaagtctgaaagtgaaggcaaagaatgtaaaatagcctctgaaaggccc
ccaatttttgatatctgcttttctccaaaagtttcatctggaaaggatgcaaatattaga
gttgagtctcttgcagagggaaatataacagattctaattctgaattgtccagtaactca
ttttctggattctcagcttccacgggttctagtgattcatctgatggttcctctgtatgt
gagagcatcatctcaaatgagcatgacggatcagagggacatacttttgttgatcccacc
cttgacattcctgataacactattgatgatagcatgggtgtaaccatgtcttcttcacca
aagtttgctactttggttgattcagtagatggtttttctacaatgcgtaaattaaatcat
actggacctggttttagtaaagaagagagtaagcttgcatcaaatggtaattcaggttca
agtatgtggaaggggaaaacaattgagccttctacggtgttttcgggattctgggataaa
gctcttgattcaagagggattaaagatgatactaagaatgacacttacccatcctgttct
gatgaatccacaggcaaaaagactgcttctgaatcttcatttcactttccattcagtacc
atgcctcctttgcatgtacgagataccaagacaaatgattctgtatctgatgatgctttt
ccaaactgtattgggaacaatatggcaagttcaggatcagcatcgtctgagaatgacaac
atgaattcttcgaaggggaggaatttctcgttcatcaacagcaaagtttccaatgttagg
agttatgttactccaagtggttctgagtctgatcaattggaatctaaagaaagctctggg
ccacctttatcatctttctcccctcagccctccagtgttggcaaaaattcagtttgtgcg
gatgctttgagcttccataactctcaatcaactggctcatccaatcttgttgtggccaac
ggtgggagcaccttgaagtccactgaaattggttgcctgacttgtgaacttgctgattct
aatttagcttctgtaactgaagaacatcattccagtacaaaacaagggaataatgacatt
gaatctggcactcgagctgtcacttcctctcaggttgctagctgttctgcaaattctaag
agtggcttgaaaacatctgttttgaaagttgttgatcagtttagaggatcaaatctgtca
aagcactttccattagttgttgggagtgatcttgctggaagacgtaatgacaagagtttt
ttcccttatgaattgtttgtcaagctttataactcgaacaaggtggagttatgcccattt
ggtcttgtaaattgtggaaacagttgttacgctaatgctgtacttcagtgcttagcattt
acaccacctctgactgcttatttgcttcaaggattacatttgaaatcatgtgcaaataaa
aaatggtgtttcacctgtgaatttgaaagattgatattgaagtcaaaggacacaaaatct
gctgtgtctcctatgggcataatctcccatctacagaatattgggagtcagcttggtaat
ggaagagaagaagatgcacatgaatttcttaggcatgttattgacacaatgcaatctgtt
tgccttacggaagctggagttaatgcatcgggctcattagaagaggacactactttaatg
ggtcaaacatttggaggttaccttcgatcaaagataaaatgcatgagatgtggagggaag
tctgagcatcaggaaaggatgatggatctgactgttgagatagaaggcgaaataacaacc
ctggtggaggcccttcgacgatttacaagcactgagactttggatggggaaaacaagtac
cactgtgtcagatgtaaatcatatgagaaggccaagaagaagctgacagtttcagaggcc
ccgaatgttcttacagttgcattaaagagatttcagtctgggaaatttgggaagctcaac
aagcctattcaatttcctgaaatacttaacttggcacctttcatgagtgggactagtgat
aaatcacccatatacagattgtatggggtagttgttcacttagatgtcatgaatgcttcc
ttttcgggtcactatgtgtgctatgtgaagaatatccaaaacaagtggtccaaggttgat
gacagtgtggtaagtccctcaatttatatttctattgctaacactgaggtagtgaacatt
ttagctgaatcaccttgtaggtgctcgccaagggccccaagattaattaggaacagaata
ctgtccccagattcaaaaagtaaagtcagtggaaagactcttacaacaaaagcaagatat
atatctacaaattctggtgtttctgaacatgccaatagttccatttcttcagatgactca
cctgccttagcctctttctattcaaagtttcaccacctgaaaaggattttggaagaagac
tcgtcaagtgataattcatcccttattagcagcaactctgatgaaggttcttgtagtaca
gatagcacccgtgattcaaccaacacagatgacttctccgaatatctttttggtgattca
gggaatggttggagtagtgtgtggaggaattctgattctgacacatcctcctcctcctca
tcttctcccttgaattggggacattcgcccctatctgatgtggaccgatatgattcagtt
tctcccgttgcagcaggcttgcgagggatagatgtttctcgtttgtcttttaacacaact
ttacagcatagaaagttagatagtagtaggattaatagcaacagtagtagtagggagact
gactcttttatgaaactaggatctaaccattttaatgatatagactctggtgtattatgt
agaaagccagggaaaagaacggattaa

DBGET integrated database retrieval system