KEGG   Glycine max (soybean): 100793496Help
Entry
100793496         CDS       T01710                                 

Definition
histidinol dehydrogenase, chloroplastic-like
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
gmx  Glycine max (soybean)
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    100793496
  Amino acid metabolism
   00340 Histidine metabolism
    100793496
Enzymes [BR:gmx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     100793496
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 473 aa AA seqDB search
MTMESALTASNWNRSLIRIRHTKPRFGAIRPTAIRCSINSYRLSNLTPSELQSLKSRPRI
DFSSIFGVVNPIVDDVHKRGDAAVKEYTSKFDKVELDKIVEVVSELPDPVLEPPIKEAFD
VAYDNIYAFHAAQKSSEKSVENMKGVQCKRVARSINSVGLYVPGGTAVLPSTALMLAVPA
QIAGCKTIVLANPPTRDGTTCKEVLYCAKKAGVTHILKAGGAQAISAMAWGTETCPKVEK
IFGPGNQYVTAAKMILQNSEAMISIDMPAGPSEVLVIADKHAIPSHVAADLLSQAEHGPD
SQVVLVIAGDGVDLNAIQEELSKQCDSLPRGEFASKALSHSFFVYACDMLEAINFSNLYA
PEHLIINVKDAEKWESFIENAGSVFLGPWTPESVGDYASGTNHVLPTYGYARMYGGVSLD
SFLKYITVQSLSEEGLRRLGPYVATMAEVEGLEAHKRAVTLRLQYIEARQVSR
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgacaatggaatctgcgcttacagcttctaactggaaccgttctttgattcggattcgc
cacactaagccacgcttcggtgcaattcgccccacagcaatacggtgctccatcaactcg
tatcgcttgtccaacctcactccctctgagcttcagagcctcaagagccgaccccgcatc
gatttctcttccattttcggtgttgttaatcctattgtcgatgatgttcacaaaagaggg
gatgctgcggttaaagaatacacttcaaagtttgataaagttgaattggataagatagtt
gaggttgtctcggagctccctgaccctgtgcttgaaccgcctattaaggaagcttttgat
gtcgcctatgataatatttatgcatttcatgctgctcagaagtcatccgagaaaagtgtt
gagaacatgaaaggagtccaatgcaagagagttgcaagaagtattaactctgtgggtctt
tatgttccagggggaactgctgtattaccttcaacagctttgatgcttgcagttcctgca
caaattgcaggatgtaaaactattgttcttgcaaatcctccaactcgggatggcactaca
tgcaaggaggtactgtattgtgcaaagaaggctggggtgactcacattctcaaagctgga
ggagcacaggccatatctgccatggcttggggaacagaaacttgtccaaaggttgaaaag
atttttggccctggaaaccaatatgtcactgctgcaaaaatgatacttcaaaacagtgaa
gccatgatttcgattgacatgccggccggtccatccgaagttttggtcattgcagacaag
catgcaattccttcccatgtagctgctgatttgctttcccaggcagagcatggcccagat
agtcaggttgttcttgtgattgctggagatggtgtggatctgaatgcaatacaggaggaa
ctcagcaagcagtgtgacagtcttccaagaggcgagtttgcctctaaagctctgagccat
agtttttttgtgtatgcgtgtgatatgcttgaggctatcaatttctcaaacttatatgca
cctgaacatctaattatcaacgtgaaggatgcagagaagtgggagagttttattgagaat
gcaggttctgtgttcttagggccttggactcctgagagtgttggtgattatgcaagtggg
acaaaccatgtccttcctacttacggttatgcaagaatgtatggtggtgtgtcattggac
tccttcctgaagtacataactgtgcagtctctctcagaggaaggtctaagaaggcttggg
ccatatgtagcaaccatggctgaagttgaaggccttgaagcccacaagcgagcagttacc
ttgagacttcagtacatagaagccaggcaggtttcaagatga

DBGET integrated database retrieval system