KEGG   Glycine max (soybean): 100794067Help
Entry
100794067         CDS       T01710                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 5-like
Organism
gmx  Glycine max (soybean)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
19
AA seq 938 aa AA seqDB search
MTEVPMCIASVSELSPDEERILIRDIALTAQANSKEGDTFFLITQRWWQHWIEYVNQEQT
NTSYDASSLSEHCDLANSSVLKRPAGIDNSDLIDDAVSEDTGMGIEIHDTLLEGRDYVLL
PQEVWNQLFRWYGGGPTLARKVISSGLSQTELAVEVYPLRLQLLMLPKNDRFPIRISKKE
TIGQLHRKACEIFDLQPDQVCIWDYYARRKHALMNDMDKTLDDANLQMDQDILVEVINNT
NNTSFAQENGSAQREMNSALVEPSKSSLSIAGGLSASRGASRGHNMDLSSSQNLNSPVRD
VENPYGTSGVTTRGSFGGLTGLLNLGNTCYMNSAIQCLVHTPEFARYFREDYHREINWQN
PLGMVGELALAFGELLRKLWAPGRTPIAPRPFKAKLVRFAPQFSGHNQHDSQELLAFLLD
GLHEDLNRVKHKPYIKSRDADGRPDEEVADEYWANHIARNDSIIVDVCQGQYKSTLVCPV
CNKVSVTFDPFMYLSLPLQPTTNRTMTVTVFACDGAALPSACTVTVPKQGRCRDLIQALS
NACSLKHNERLVLVEIRNHLIHRYFEDPLQLLSNIKDDDRLAAYKVPKIDKNTKYLQLIH
RRREQSSDSHIISGWKPYGTPIVSLISCDDTVTRGDIQVIVNRMLSPLLRKGINVEQATT
SETSIPKATSDQCSFNSSDDACAANMVSNSVNKDTTNSKAPPVPLPTLPLLLVDDNNACI
DLSMGEEKVVKLSPLSPKILVYIDWSQKLLEKYDTHPLETLPEVLKYGPVTKKARTEPLS
LYTCLEAFLREEPLVPEDMWYCPKCKERRQASKKLDLWRLPEVLVIHLKRFSYSRSMKHK
LETFVNFPIHDFDLTNYIANKNNTRRQLYELYALTNHYGSMGSGHYTAHIKLLDENRWYN
FDDSHISLISEDEVNTAAAYVLFYRRVKNDDAAVSNGA
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atgacagaggtgccgatgtgtatcgccagcgtctctgagctgagtccagatgaggagagg
atcttgatcagagacattgctctcactgcccaagctaacagcaaagaaggcgacaccttc
ttcttaatcactcagagatggtggcaacattggattgaatatgtgaaccaggaacagaca
aacacttcatatgatgcatcttccttatcagaacattgtgatttggccaattcaagtgtg
ttaaagaggccagctggtattgataattctgatttgatagatgatgctgtgtcagaggac
actggtatgggtattgagattcatgatacacttttagaaggccgtgactatgtattactt
ccccaagaagtttggaaccaattatttagatggtatggcggtggacctacattggcaagg
aaagttattagttcaggtctttcccagactgaattggcagtagaggtgtatcctttacgg
cttcaattacttatgttgccaaaaaatgatcgtttccctataagaataagcaagaaggaa
accattggacagcttcacagaaaagcttgtgaaatatttgatcttcagccagaccaagtg
tgtatttgggattactatgcccgtcgaaagcatgctttgatgaatgacatggacaaaact
ctcgacgatgctaatttacaaatggaccaagatattcttgttgaggtcatcaacaataca
aacaacacaagttttgctcaagaaaatgggtctgcacagagggaaatgaattctgctctt
gtggagccttcaaaatctagcttatcgattgctggtggcttatctgctagcagaggtgca
tctagaggccacaacatggacctttcttcatctcagaacctaaattctccagttagagat
gtggaaaacccttatggaaccagtggtgtcaccacaagaggttcattcggtggtctcact
ggattgctgaatcttggcaatacttgttacatgaatagtgcaatacagtgccttgttcat
acaccggaatttgctaggtacttcagggaagactatcaccgagagataaattggcaaaat
ccattgggcatggttggtgaactagccctagcatttggtgagttgcttcgaaaactatgg
gcacctgggcgaacaccaatcgctcctcggccttttaaagcaaagcttgttcgctttgca
cctcagttcagtgggcacaatcaacatgattctcaggagcttttagcatttcttcttgat
ggtcttcatgaagacttgaatcgtgtaaagcacaaaccatatataaaatctcgagatgcc
gatggccggcctgatgaagaagtggctgacgaatattgggcaaatcatattgctcgtaat
gattccataattgttgatgtatgccagggacaatacaagtcaactttggtttgtccagtt
tgtaataaagtctctgtcacatttgatccttttatgtacctttccctgccactccagccc
accaccaatagaaccatgacagtgacagtttttgcttgtgatggagccgcccttccatct
gcttgtacagtaactgtccctaagcagggacgatgcagggatctcatacaggcacttagc
aatgcttgctcattgaagcacaatgagaggctagtacttgtggagatacgaaaccatttg
atccatagatattttgaagatcctcttcaattgttgtctaatattaaagatgatgaccgt
cttgctgcttacaaggttccaaagatagacaagaacacaaagtatctccagttgatacat
cgccgaagagagcagagtagtgactcacacatcatatccggatggaaaccatatggaaca
cctattgtttcgttgatttcatgtgatgatacagtcacaagaggtgatatacaagtaata
gttaatcgtatgctctctccactgctaaggaaaggtatcaatgtagaacaagctaccact
tctgaaacaagcatcccaaaagcaacatctgatcaatgcagttttaattcttctgatgat
gcatgtgctgccaacatggtgtcaaattcagtaaataaggatactaccaattcaaaggcg
ccgccagtgccattgccaacattacctcttctcttggtagatgataacaatgcttgcatt
gatctttcaatgggagaggaaaaagtagttaaactgtcgccattgtctccaaagatttta
gtgtatattgattggtctcagaagcttctggagaagtatgatactcatccacttgagact
ttgcctgaagttctaaaatatggacctgtaaccaagaaagctcgtactgaacctctctcc
ttgtacacctgcttggaagcttttctgcgtgaagaacctctggtgcccgaagatatgtgg
tactgtcctaaatgcaaagagagacgacaagcaagcaagaagcttgatttgtggagactc
ccagaggttttggtcattcatttgaagaggttttcctacagcaggtcaatgaagcataaa
ctggagacttttgttaactttcccattcatgattttgatttaaccaattacatagccaac
aaaaacaacactcggcgtcaactgtacgaactgtatgcccttacaaatcattatggcagt
atgggtagcgggcattacactgcacatattaagcttttagatgagaacaggtggtacaat
tttgatgacagccacatatcactcataagtgaagatgaggttaacactgctgctgcctat
gtgctattttaccgcagggtgaagaatgacgatgccgctgttagcaatggggcttag

DBGET integrated database retrieval system