KEGG   Glycine max (soybean): 100794521Help
Entry
100794521         CDS       T01710                                 

Definition
histone-lysine N-methyltransferase ASHH3-like
Orthology
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
gmx  Glycine max (soybean)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100794521
Enzymes [BR:gmx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100794521
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
16
AA seq 349 aa AA seqDB search
MPAMKKNPELTCIGSVFNMLGKELGEPVDFELPDSFNKSKPMQYTYIKRNIYLTKKVKRS
RFDDDGIFCSCTPSPGSTSVCGRDCHCGMLLSSCSSGCKCGSSCLNKPFQNRPVKKMKLV
KTEKCGSGIVADEDIKLGEFVIEYVGEVIDDKTCEERLWNMKHSGETNFYLCEINRDMVI
DATYKGNKSRYINHSCCPNTEMQKWIIDGETRIGIFATRDIQKGEHLTYDYQFVQFGADQ
DCHCGAAECRRKLGVRPTKSKLSSDAALKLVAYQVYQNGGLQIGSSRVVDQPKCLHNCIG
EVIRIKHLENERFGIIKRFDKYSRKHSIMFEDGCVEIYDMSKEDFELVR
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccatgaaaaagaatcctgagctaacttgtattggttctgtattcaacatgttg
gggaaggagcttggagaacctgtagactttgaacttccagattcatttaataaatccaag
ccaatgcagtacacctatataaaacgcaatatatatctcactaagaaggtcaagagatcc
cggtttgatgatgatggcatattctgttcctgtactccttcccctggatctactagtgta
tgtggtagagattgccactgtggaatgcttctgtctagctgttcatcaggctgtaaatgt
gggagctcctgtctcaacaaaccatttcagaaccgtcctgtgaaaaaaatgaaattggtc
aagaccgagaaatgtggttctggaattgtggcggatgaagatatcaagcttggggagttt
gtcattgaatatgttggagaagtcattgatgacaaaacatgcgaggaaaggctttggaac
atgaaacatagtggggaaacaaacttctacttatgtgaaatcaatcgagatatggtgata
gatgcaacatacaagggaaacaaatcaagatacatcaatcatagttgctgccccaatact
gagatgcagaaatggataattgatggtgaaacaagaattggcatatttgcaactcgtgac
atacaaaagggcgagcatctgacttatgattaccagtttgttcaatttggtgcagatcaa
gattgccactgtggtgctgctgagtgtaggcgtaagttgggtgtccgacctaccaagtct
aaactttcttcagatgctgcattaaaattagttgcatatcaggtttatcagaatggaggt
ttgcaaattggaagttctcgtgttgttgaccaaccaaagtgcttgcacaattgcattggt
gaagttattaggataaaacatcttgaaaatgagaggtttggaattattaaacgatttgat
aagtattcccgaaaacattcgatcatgtttgaggatggttgtgttgaaatttatgacatg
tcaaaagaggactttgaacttgtgagatag

DBGET integrated database retrieval system