KEGG   Glycine max (soybean): 100795556Help
Entry
100795556         CDS       T01710                                 

Definition
ubiquitin carboxyl-terminal hydrolase 26-like
Orthology
K11858  
ubiquitin carboxyl-terminal hydrolase 48 [EC:3.1.2.15]
Organism
gmx  Glycine max (soybean)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 1080 aa AA seqDB search
MTRPTTRSKNKRQRQGDDDGGGTSDIWRKIHITGAVTEDDMNQLYMIWKPVCSGCRVNTK
DNPNCFCALVPPANGTRKSGLWQKMADFVESLGPDPNMDLRVSDSSPAGLTNLGATCYAN
SILQCLYMNKSFREGIFSVEPDVLQQQPVLDQLTQLFVHLHASKMAFIDSSPFVKTLELD
NGIQQDSHEFLTLLLSLLERCLSHSKIAKARTIVQDLFRGSVSHVTTCSQCGRDSEASSK
MEDFYGLELNIKGLKGLDESLDDYLAIEELHGDNQYFCESCKTRVDATRSIKLCTLPDVL
NFQLKRYVFLPQNTMKKKVTSAFSFPAELDMRHRLSEPSQFELIYDLSAVLIHKGTAVNS
GHYIAHIKDVNTGQWWEFDDENVTNLGCHPFGEGTSSTSKSVKTDVLHSNCSEAMLADSN
GLDATHAQSLLVETFSSSDAYMLMYHLKHSKNVGEKGGIVYGANLEVEGNAVTAQDSACL
PSHFCKEIQNFNASYLDSCEQYKHRKELELSHINERRQEVRSILAEAPTQPLEQPYFWIC
SDWLRQWADNIIPIALDNTSIQCSHGKVPVSKVTSMKRLSSKAWDKLLSKYGGGPTLSHE
DCCWDCLIDGAQNVVSADTYRDQRESLKRLARDILDGNCEDGMYYVSRPWLQQWWKRKVV
DAPSEADAGPTAAICCPHGQLMPEQAVGAKRLLVPEDFWLFLYKDAISVKPDDPLGCPTF
PLDSRRCSQCSDELSEEACLEDSLRLVKQMQRQNHEKLFVGKSMPLSLHCKYFLVPSSWI
SKWRNYINLAVKNSDKPETLDGVIDSLMCEKHSRLIERPPELVFRRGAIIARESSVSGLT
IISENDWKCFCEEWSGIETKGISARIENVNDSENALTGSCREMPICEDQLNTWDKVNNES
GNGHIVIKTCPEVCESCVGEKESCELMQKLNYCNQDISVILVRGKEVPKSILEASKGFVE
IDRRVSKRSRKTKNGSSISLKVSASTSIYQLKMMIWESFAVVKENQILQKGDRTIDVDNE
YATLVDANIFAGDQIIVRDSEIHENRDIADELCDEEMETQHTEAGFRGTLLTSNVSSQVV
NT seq 3243 nt NT seq  +upstreamnt  +downstreamnt
atgactagaccaacaactcgaagtaaaaataaaaggcagagacagggggatgatgatggt
ggtggcacttctgacatatggaggaaaattcacataacgggtgcggtgactgaagatgat
atgaatcaactgtatatgatttggaagccagtctgttcaggctgtcgtgttaatactaaa
gacaacccgaattgcttctgtgcattggttccacctgcgaatggtacccgaaagtctggt
ttatggcagaagatggccgactttgtcgaaagtcttggtcccgacccaaatatggatctt
cgtgtttctgatagttcacctgcaggtctgacaaatcttggcgcaacatgctatgccaac
agtatactacagtgcttgtatatgaataaatctttccgagaaggcatattttctgtagaa
ccggatgttttacaacaacaaccagtgttagatcaactgactcaactttttgtacatttg
catgctagtaaaatggctttcatagattcttctccatttgtaaaaacattggagctagac
aatggaattcagcaggatagccacgagttcttgacattgcttctgtcattacttgagcgt
tgtttgagccattccaaaattgccaaggcaagaacaatagttcaagatctttttcgagga
agtgtgtctcatgtgacaacgtgttcgcaatgtggaagagactctgaggcttcttccaaa
atggaagacttctatgggttagagttgaatatcaagggactgaaaggtttagatgagagc
ctagatgattatcttgctattgaagagcttcatggagacaatcaatatttctgtgagtca
tgtaaaacaagagttgatgctactcgcagcatcaagctgtgtacattgcctgatgtactt
aattttcaacttaaacgttatgtcttccttccacagaatacaatgaagaagaaagttact
tctgcattttcatttcctgctgaacttgatatgcgccatagattgtctgagccatctcag
tttgaattgatatatgacttgtcagctgtactgattcacaaaggaactgctgttaatagt
ggtcattacattgcccatatcaaggatgtaaacactgggcaatggtgggagtttgatgac
gagaatgttactaacttgggttgccatccatttggggaaggaacttcttctacttctaaa
tctgttaagacagatgtacttcattctaattgctctgaagcaatgctagctgacagtaat
ggtttagatgccactcatgcgcaatctttgcttgtggagacattttcatctagtgatgct
tacatgttgatgtaccatcttaagcatagcaaaaatgttggtgaaaaggggggaatcgtt
tatggtgctaaccttgaagtagagggcaatgcagttactgcacaagacagtgcttgtctt
ccttctcatttttgcaaagagattcaaaatttcaatgcttcatatcttgattcttgcgag
cagtacaaacataggaaagagttagaattgagccatatcaatgagaggagacaggaagtt
cgatccattttagctgaagctcctactcaaccactggagcaaccgtatttttggatttgt
agtgactggcttcgccagtgggctgacaacattattccaattgctcttgacaatacatct
atccaatgttcacatgggaaagtcccagtgtcaaaggttacctcaatgaagcgattatct
tctaaagcatgggataaattattgtctaagtatggtgggggaccaactctttctcatgaa
gactgttgttgggattgtctgattgatggggctcagaatgtggtgtcagctgacacttat
cgggatcaaagagaatcattgaagcgacttgcacgggatattctcgatggaaattgtgaa
gacggaatgtactatgtgtctagaccatggttgcagcaatggtggaaaagaaaagttgtt
gatgctccatctgaagctgatgctggaccaacagcagccatttgttgtccacatgggcaa
cttatgcctgagcaagctgttggtgctaagcggttgcttgttcctgaggatttctggctt
ttcttatataaagatgccatttctgtaaaacctgatgatcctctaggttgccctactttt
cctttagactccagaaggtgttcccaatgcagtgatgaattatctgaagaggcttgcttg
gaggactctttgagattagtaaaacaaatgcaacgccaaaatcatgagaaattatttgtt
ggtaaaagtatgccgctttctctacattgcaagtatttcttagttccttcttcgtggatt
tcaaaatggagaaattacattaatttggctgtcaagaattcagataaacctgaaacttta
gatggggtaatcgattcactgatgtgtgaaaagcattcacggctcattgaaaggcctcct
gaactggttttcagacgtggtgctataattgccagagaatcttctgtaagtggcttaacc
atcatatctgagaatgattggaaatgcttctgtgaagaatggagtggtattgagaccaaa
ggaatatctgcaagaattgagaatgttaatgattcagaaaatgctttgactggatcctgc
agagagatgccaatatgtgaggatcaacttaacacttgggataaagtgaataatgaaagt
gggaatggacacattgtgattaagacttgtcctgaggtttgtgaaagttgcgttggagaa
aaggaaagctgtgagttaatgcagaaacttaactattgcaatcaggacattagtgtaatt
cttgtccgtggaaaggaggtccctaaatcaatcttagaggcttcaaagggctttgttgaa
atagacaggcgggtttccaaacgttcccggaagactaaaaatgggagttccattagtcta
aaagtttctgcttcaacatctatttaccagctgaaaatgatgatatgggaatcctttgcg
gttgtcaaagaaaaccagatactacaaaaaggtgatagaacaattgatgttgataatgaa
tatgctacgcttgtggatgcaaacatatttgctggagatcagattattgtgagggactcc
gagatccatgaaaatcgagatattgcagatgagctttgtgatgaggaaatggaaacacaa
cataccgaggcaggatttcgtggaacactcttaacatcgaacgtttcatctcaggtggtt
tag

DBGET integrated database retrieval system